Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PDY5

Protein Details
Accession A0A1J9PDY5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
192-217IAIFAFWRRRKRSRKAKEATSHEQQSHydrophilic
NLS Segment(s)
PositionSequence
199-208RRRKRSRKAK
Subcellular Location(s) extr 21, cyto 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKLLHSAYCILGFAYTVSAVCYYRNGNVTPADVPCHDTGPSTCCPVGYACLSNNVCVNPKAENETVGYIRGSCTDKSWRAGQCPAFCIRGGKPWNDTLGGVQPMRKCENTDEDLYYCVDDNVGAVDCDAKNDAVVSFVGQPTTVTVIGATQTNSPTPTATSTPDGGGLDAAKTAAIGAGVGVPIGVVLIALIAIFAFWRRRKRSRKAKEATSHEQQSETYKKQGPYMEAELIEAPRNEIVEAPSSPAVGRKPHTALPTSPVELPAQPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.08
5 0.09
6 0.1
7 0.1
8 0.13
9 0.14
10 0.18
11 0.21
12 0.21
13 0.22
14 0.24
15 0.25
16 0.25
17 0.24
18 0.23
19 0.21
20 0.24
21 0.22
22 0.22
23 0.2
24 0.19
25 0.19
26 0.21
27 0.22
28 0.22
29 0.21
30 0.19
31 0.2
32 0.19
33 0.21
34 0.2
35 0.21
36 0.17
37 0.26
38 0.26
39 0.26
40 0.27
41 0.26
42 0.25
43 0.23
44 0.24
45 0.18
46 0.19
47 0.24
48 0.22
49 0.22
50 0.2
51 0.23
52 0.22
53 0.2
54 0.19
55 0.13
56 0.13
57 0.15
58 0.16
59 0.13
60 0.16
61 0.23
62 0.26
63 0.28
64 0.35
65 0.35
66 0.36
67 0.42
68 0.44
69 0.39
70 0.39
71 0.39
72 0.34
73 0.31
74 0.3
75 0.24
76 0.27
77 0.28
78 0.27
79 0.27
80 0.28
81 0.29
82 0.27
83 0.26
84 0.19
85 0.2
86 0.21
87 0.18
88 0.19
89 0.19
90 0.22
91 0.24
92 0.23
93 0.21
94 0.21
95 0.26
96 0.27
97 0.27
98 0.26
99 0.23
100 0.24
101 0.22
102 0.2
103 0.14
104 0.1
105 0.08
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.06
113 0.06
114 0.06
115 0.07
116 0.06
117 0.05
118 0.06
119 0.06
120 0.05
121 0.05
122 0.05
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.07
130 0.06
131 0.05
132 0.05
133 0.05
134 0.06
135 0.07
136 0.07
137 0.06
138 0.07
139 0.08
140 0.09
141 0.09
142 0.09
143 0.09
144 0.1
145 0.11
146 0.12
147 0.14
148 0.14
149 0.14
150 0.15
151 0.14
152 0.12
153 0.11
154 0.09
155 0.07
156 0.06
157 0.06
158 0.04
159 0.04
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.02
170 0.02
171 0.02
172 0.02
173 0.01
174 0.01
175 0.01
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.04
183 0.1
184 0.16
185 0.25
186 0.33
187 0.44
188 0.54
189 0.65
190 0.75
191 0.8
192 0.86
193 0.86
194 0.89
195 0.88
196 0.87
197 0.84
198 0.81
199 0.76
200 0.65
201 0.58
202 0.48
203 0.46
204 0.44
205 0.4
206 0.37
207 0.38
208 0.39
209 0.43
210 0.46
211 0.41
212 0.4
213 0.42
214 0.39
215 0.33
216 0.33
217 0.3
218 0.27
219 0.27
220 0.2
221 0.17
222 0.14
223 0.14
224 0.13
225 0.13
226 0.13
227 0.15
228 0.15
229 0.18
230 0.17
231 0.17
232 0.17
233 0.2
234 0.21
235 0.23
236 0.26
237 0.29
238 0.32
239 0.37
240 0.42
241 0.42
242 0.41
243 0.41
244 0.43
245 0.4
246 0.37
247 0.33
248 0.31