Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QE49

Protein Details
Accession A0A1J9QE49    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-93KSTGHARKGYSRRHPSSRKRSLBasic
NLS Segment(s)
PositionSequence
76-92HARKGYSRRHPSSRKRS
Subcellular Location(s) nucl 15, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MTSETALGVLLSSIKLSQELKSEFEKSSSQTKKPKGDGILSAHTKVGHLQKVMETLGACLCPTLRRCQKGVKSTGHARKGYSRRHPSSRKRSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.1
4 0.11
5 0.17
6 0.19
7 0.22
8 0.25
9 0.28
10 0.26
11 0.27
12 0.27
13 0.23
14 0.32
15 0.34
16 0.37
17 0.43
18 0.5
19 0.54
20 0.56
21 0.58
22 0.52
23 0.49
24 0.47
25 0.44
26 0.44
27 0.38
28 0.35
29 0.3
30 0.27
31 0.24
32 0.22
33 0.21
34 0.16
35 0.14
36 0.14
37 0.14
38 0.16
39 0.16
40 0.14
41 0.1
42 0.09
43 0.09
44 0.09
45 0.08
46 0.06
47 0.07
48 0.1
49 0.11
50 0.21
51 0.28
52 0.31
53 0.34
54 0.44
55 0.52
56 0.57
57 0.62
58 0.59
59 0.59
60 0.66
61 0.72
62 0.71
63 0.64
64 0.58
65 0.61
66 0.63
67 0.66
68 0.66
69 0.68
70 0.68
71 0.77
72 0.85
73 0.86