Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9RCB4

Protein Details
Accession A0A1J9RCB4    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-33ARAPKPQNTSSPRRQRRLSRKKWGLDLEYHydrophilic
NLS Segment(s)
PositionSequence
16-26PRRQRRLSRKK
Subcellular Location(s) nucl 20.5, mito_nucl 13.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MGVSARAPKPQNTSSPRRQRRLSRKKWGLDLEYKFRELSCPQQSDFSMHLHCNVKNRYMEVAKVDFDRLPGEAIEWMFQDPRDNDLMDTERRGKAGDGSVLLKVYEVITEMPWESEWKGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.72
3 0.77
4 0.77
5 0.81
6 0.82
7 0.85
8 0.87
9 0.87
10 0.87
11 0.87
12 0.85
13 0.85
14 0.81
15 0.75
16 0.73
17 0.68
18 0.66
19 0.59
20 0.54
21 0.46
22 0.39
23 0.36
24 0.29
25 0.31
26 0.3
27 0.3
28 0.3
29 0.32
30 0.33
31 0.33
32 0.32
33 0.26
34 0.21
35 0.18
36 0.22
37 0.22
38 0.23
39 0.27
40 0.27
41 0.28
42 0.27
43 0.28
44 0.27
45 0.25
46 0.25
47 0.21
48 0.2
49 0.17
50 0.17
51 0.17
52 0.13
53 0.13
54 0.12
55 0.09
56 0.09
57 0.08
58 0.07
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.08
65 0.08
66 0.12
67 0.11
68 0.14
69 0.15
70 0.15
71 0.14
72 0.17
73 0.21
74 0.18
75 0.21
76 0.23
77 0.22
78 0.22
79 0.23
80 0.2
81 0.2
82 0.22
83 0.21
84 0.19
85 0.2
86 0.2
87 0.2
88 0.19
89 0.16
90 0.13
91 0.1
92 0.08
93 0.08
94 0.08
95 0.08
96 0.1
97 0.1
98 0.11
99 0.11
100 0.14