Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PWB8

Protein Details
Accession A0A1J9PWB8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
93-119LTTLRGHMRFKQKRRSSRDGGRKILKSHydrophilic
NLS Segment(s)
PositionSequence
101-118RFKQKRRSSRDGGRKILK
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 1, golg 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
CDD cd00024  CD_CSD  
Amino Acid Sequences MDEVGTSGRAPHDSISPQPEGRPEVSAGHAGATQEEWLVKKILDSRIRLRNGKPRLEYRVAWRPWQPRSDLIPGCEELVKEFHTEGKDERPSLTTLRGHMRFKQKRRSSRDGGRKILKSIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.3
4 0.3
5 0.3
6 0.32
7 0.31
8 0.3
9 0.27
10 0.23
11 0.21
12 0.22
13 0.22
14 0.19
15 0.16
16 0.15
17 0.13
18 0.12
19 0.1
20 0.09
21 0.07
22 0.08
23 0.08
24 0.08
25 0.09
26 0.09
27 0.1
28 0.15
29 0.22
30 0.27
31 0.3
32 0.36
33 0.43
34 0.48
35 0.5
36 0.5
37 0.51
38 0.53
39 0.55
40 0.52
41 0.49
42 0.51
43 0.51
44 0.48
45 0.46
46 0.48
47 0.43
48 0.42
49 0.43
50 0.42
51 0.41
52 0.43
53 0.38
54 0.33
55 0.37
56 0.42
57 0.37
58 0.33
59 0.31
60 0.29
61 0.28
62 0.24
63 0.19
64 0.12
65 0.13
66 0.12
67 0.11
68 0.1
69 0.13
70 0.13
71 0.14
72 0.15
73 0.21
74 0.24
75 0.24
76 0.25
77 0.24
78 0.25
79 0.26
80 0.29
81 0.24
82 0.24
83 0.32
84 0.37
85 0.39
86 0.44
87 0.53
88 0.58
89 0.65
90 0.72
91 0.73
92 0.77
93 0.83
94 0.85
95 0.84
96 0.85
97 0.87
98 0.85
99 0.85
100 0.84
101 0.78