Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QXL9

Protein Details
Accession A0A1J9QXL9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-92ADNDGTKEKKEKKKQLKQGVPMELHydrophilic
NLS Segment(s)
PositionSequence
77-82KKEKKK
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 11, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010301  RRP1  
Gene Ontology GO:0005634  C:nucleus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF05997  Nop52  
Amino Acid Sequences MLEEGPLCPINFDPAGNYGNGDPAVRMHKGPDGLRYHLLDIWLDEIEKVAVVEDEGEAGEEGNGDADSADNDGTKEKKEKKKQLKQGVPMELLLRPIVRLQGKSISKLVRKRAGEVLDDERLVEWGVRERKKDGDDDEDDDDEEEEWGGIDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.17
4 0.18
5 0.13
6 0.15
7 0.15
8 0.13
9 0.1
10 0.12
11 0.16
12 0.16
13 0.16
14 0.16
15 0.19
16 0.23
17 0.25
18 0.3
19 0.3
20 0.32
21 0.36
22 0.35
23 0.33
24 0.29
25 0.29
26 0.21
27 0.17
28 0.15
29 0.11
30 0.1
31 0.08
32 0.07
33 0.07
34 0.06
35 0.06
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.04
57 0.04
58 0.04
59 0.06
60 0.07
61 0.08
62 0.15
63 0.23
64 0.33
65 0.43
66 0.53
67 0.63
68 0.72
69 0.81
70 0.85
71 0.84
72 0.83
73 0.81
74 0.75
75 0.65
76 0.55
77 0.46
78 0.36
79 0.29
80 0.21
81 0.13
82 0.09
83 0.08
84 0.12
85 0.13
86 0.13
87 0.15
88 0.23
89 0.24
90 0.26
91 0.3
92 0.32
93 0.37
94 0.42
95 0.48
96 0.48
97 0.48
98 0.49
99 0.51
100 0.48
101 0.44
102 0.42
103 0.39
104 0.33
105 0.32
106 0.28
107 0.22
108 0.19
109 0.17
110 0.13
111 0.09
112 0.15
113 0.24
114 0.28
115 0.3
116 0.33
117 0.39
118 0.41
119 0.45
120 0.42
121 0.42
122 0.42
123 0.44
124 0.45
125 0.4
126 0.37
127 0.33
128 0.28
129 0.2
130 0.16
131 0.12
132 0.07