Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9PYW6

Protein Details
Accession A0A1J9PYW6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
23-52TANKEWPRKSLQKRKRVHRKKTRRGDLLLRBasic
NLS Segment(s)
PositionSequence
26-46KEWPRKSLQKRKRVHRKKTRR
Subcellular Location(s) nucl 19.5, mito_nucl 13.166, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MSHHNGDKDTFLPIRPQKLTLRTANKEWPRKSLQKRKRVHRKKTRRGDLLLRTTAPLPLVELQHPTGQRQYPHPSSGPLKFQKAEDDQNPEENWQTLNEMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.41
4 0.42
5 0.47
6 0.52
7 0.51
8 0.56
9 0.53
10 0.56
11 0.61
12 0.64
13 0.67
14 0.62
15 0.6
16 0.58
17 0.64
18 0.7
19 0.71
20 0.72
21 0.73
22 0.8
23 0.84
24 0.88
25 0.89
26 0.89
27 0.89
28 0.91
29 0.92
30 0.94
31 0.93
32 0.87
33 0.81
34 0.79
35 0.75
36 0.7
37 0.61
38 0.5
39 0.41
40 0.35
41 0.31
42 0.22
43 0.14
44 0.09
45 0.09
46 0.1
47 0.1
48 0.12
49 0.13
50 0.16
51 0.17
52 0.17
53 0.19
54 0.21
55 0.22
56 0.26
57 0.33
58 0.33
59 0.36
60 0.36
61 0.37
62 0.39
63 0.41
64 0.45
65 0.42
66 0.43
67 0.41
68 0.41
69 0.43
70 0.43
71 0.47
72 0.43
73 0.46
74 0.43
75 0.46
76 0.46
77 0.41
78 0.37
79 0.31
80 0.26
81 0.19