FuNGI

A0A1J9PXD6

Protein Details

Accession

A0A1J9PXD6

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
379-399	IDPNWESKRRIARRKEVVVGV	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

extr 14, cyto 7, mito 3, pero 2

Family & Domain DBs

InterPro	View protein in InterPro IPR036691 Endo/exonu/phosph_ase_sf IPR005135 Endo/exonuclease/phosphatase IPR046985 IP5 IPR000300 IPPc
Gene Ontology	GO:0016020 C:membrane GO:0016791 F:phosphatase activity GO:0046856 P:phosphatidylinositol dephosphorylation
Pfam	View protein in Pfam PF03372 Exo_endo_phos

Amino Acid Sequences

MACLGVYILTFNCARKAIQHDTLASHLFDALPESGPQSTDLPEILVLSLQEIAPIAYAFLGGSFLDPYFDALRRSVSIAARDQHYKTVVTKNVGMTAVMVFVRGDVAENIAWIETAEVGVGVQEAGNKGAAGARIGYHIGDGTVDLTFVAAHLAPDEWAVARRNEDWKNIVQRLVFSRVKNKGDNTQGHDERNEEDVPLLQTESSNTNGDVGLYSPGSYLFVAGDFNYRVSLARPGPNDHRKFPRPTEDISSPYHYSHLLAKDQLTQELQEQRTLQDLSEAPIKFLPTYKFVSPTHHPDLGGLFETWTWAKNRWPSWCDRILYRDVPSSTSAGQGGIEVHRYDALPIIPTSDHRPVALSVSVPLKPASAPAVFLPPFEIDPNWESKRRIARRKEVVVGVAAYLGLTREGNVLLLSIALGLTLGYFALQLFRAG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.17
2	0.22
3	0.3
4	0.35
5	0.4
6	0.43
7	0.43
8	0.44
9	0.47
10	0.43
11	0.35
12	0.28
13	0.21
14	0.17
15	0.14
16	0.15
17	0.12
18	0.12
19	0.12
20	0.13
21	0.13
22	0.14
23	0.16
24	0.14
25	0.15
26	0.15
27	0.14
28	0.13
29	0.13
30	0.13
31	0.11
32	0.1
33	0.08
34	0.08
35	0.09
36	0.07
37	0.07
38	0.07
39	0.07
40	0.07
41	0.07
42	0.06
43	0.05
44	0.05
45	0.04
46	0.04
47	0.05
48	0.05
49	0.05
50	0.06
51	0.06
52	0.07
53	0.07
54	0.1
55	0.12
56	0.14
57	0.15
58	0.15
59	0.17
60	0.18
61	0.2
62	0.22
63	0.22
64	0.24
65	0.28
66	0.31
67	0.32
68	0.36
69	0.35
70	0.35
71	0.34
72	0.31
73	0.31
74	0.35
75	0.36
76	0.35
77	0.37
78	0.34
79	0.36
80	0.34
81	0.29
82	0.22
83	0.17
84	0.16
85	0.12
86	0.11
87	0.07
88	0.07
89	0.07
90	0.06
91	0.07
92	0.05
93	0.07
94	0.07
95	0.07
96	0.07
97	0.07
98	0.07
99	0.06
100	0.06
101	0.04
102	0.04
103	0.04
104	0.03
105	0.03
106	0.03
107	0.03
108	0.03
109	0.03
110	0.04
111	0.05
112	0.06
113	0.06
114	0.06
115	0.06
116	0.08
117	0.08
118	0.07
119	0.07
120	0.07
121	0.08
122	0.09
123	0.09
124	0.07
125	0.07
126	0.06
127	0.06
128	0.05
129	0.05
130	0.04
131	0.04
132	0.04
133	0.04
134	0.04
135	0.04
136	0.04
137	0.04
138	0.04
139	0.04
140	0.04
141	0.05
142	0.05
143	0.05
144	0.05
145	0.07
146	0.09
147	0.1
148	0.11
149	0.14
150	0.21
151	0.23
152	0.25
153	0.26
154	0.3
155	0.37
156	0.37
157	0.36
158	0.3
159	0.3
160	0.31
161	0.35
162	0.34
163	0.28
164	0.34
165	0.39
166	0.42
167	0.43
168	0.42
169	0.41
170	0.45
171	0.48
172	0.46
173	0.48
174	0.46
175	0.44
176	0.43
177	0.37
178	0.31
179	0.29
180	0.23
181	0.14
182	0.12
183	0.12
184	0.12
185	0.11
186	0.1
187	0.06
188	0.06
189	0.07
190	0.09
191	0.1
192	0.09
193	0.09
194	0.09
195	0.09
196	0.09
197	0.08
198	0.07
199	0.06
200	0.05
201	0.06
202	0.05
203	0.05
204	0.06
205	0.06
206	0.05
207	0.04
208	0.04
209	0.05
210	0.05
211	0.06
212	0.06
213	0.06
214	0.06
215	0.06
216	0.06
217	0.07
218	0.12
219	0.13
220	0.17
221	0.18
222	0.22
223	0.31
224	0.4
225	0.43
226	0.44
227	0.49
228	0.51
229	0.55
230	0.56
231	0.56
232	0.49
233	0.49
234	0.5
235	0.45
236	0.42
237	0.4
238	0.4
239	0.32
240	0.29
241	0.27
242	0.21
243	0.19
244	0.2
245	0.2
246	0.17
247	0.17
248	0.17
249	0.21
250	0.22
251	0.22
252	0.18
253	0.16
254	0.18
255	0.24
256	0.24
257	0.21
258	0.21
259	0.2
260	0.23
261	0.23
262	0.19
263	0.16
264	0.15
265	0.15
266	0.21
267	0.21
268	0.18
269	0.19
270	0.2
271	0.16
272	0.19
273	0.19
274	0.17
275	0.21
276	0.21
277	0.25
278	0.26
279	0.31
280	0.33
281	0.38
282	0.41
283	0.39
284	0.37
285	0.33
286	0.33
287	0.28
288	0.25
289	0.17
290	0.11
291	0.09
292	0.11
293	0.1
294	0.11
295	0.11
296	0.12
297	0.17
298	0.24
299	0.29
300	0.35
301	0.38
302	0.43
303	0.48
304	0.53
305	0.5
306	0.46
307	0.47
308	0.45
309	0.44
310	0.41
311	0.39
312	0.33
313	0.34
314	0.32
315	0.29
316	0.23
317	0.22
318	0.19
319	0.14
320	0.13
321	0.11
322	0.11
323	0.1
324	0.12
325	0.1
326	0.11
327	0.11
328	0.12
329	0.11
330	0.12
331	0.12
332	0.12
333	0.11
334	0.13
335	0.13
336	0.15
337	0.21
338	0.24
339	0.24
340	0.22
341	0.24
342	0.22
343	0.25
344	0.24
345	0.19
346	0.16
347	0.19
348	0.2
349	0.19
350	0.18
351	0.16
352	0.14
353	0.16
354	0.17
355	0.13
356	0.14
357	0.14
358	0.22
359	0.21
360	0.21
361	0.22
362	0.19
363	0.2
364	0.2
365	0.19
366	0.15
367	0.18
368	0.26
369	0.28
370	0.32
371	0.33
372	0.39
373	0.49
374	0.56
375	0.63
376	0.66
377	0.72
378	0.77
379	0.83
380	0.82
381	0.75
382	0.67
383	0.59
384	0.5
385	0.39
386	0.29
387	0.21
388	0.14
389	0.11
390	0.09
391	0.07
392	0.06
393	0.07
394	0.08
395	0.08
396	0.09
397	0.09
398	0.08
399	0.07
400	0.07
401	0.06
402	0.05
403	0.05
404	0.04
405	0.04
406	0.03
407	0.03
408	0.03
409	0.03
410	0.03
411	0.04
412	0.04
413	0.06

A0A1J9PXD6

3D AlphaFold-predicted Structure Viewer