Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PXD6

Protein Details
Accession A0A1J9PXD6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
379-399IDPNWESKRRIARRKEVVVGVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, cyto 7, mito 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
IPR046985  IP5  
IPR000300  IPPc  
Gene Ontology GO:0016020  C:membrane  
GO:0016791  F:phosphatase activity  
GO:0046856  P:phosphatidylinositol dephosphorylation  
Pfam View protein in Pfam  
PF03372  Exo_endo_phos  
Amino Acid Sequences MACLGVYILTFNCARKAIQHDTLASHLFDALPESGPQSTDLPEILVLSLQEIAPIAYAFLGGSFLDPYFDALRRSVSIAARDQHYKTVVTKNVGMTAVMVFVRGDVAENIAWIETAEVGVGVQEAGNKGAAGARIGYHIGDGTVDLTFVAAHLAPDEWAVARRNEDWKNIVQRLVFSRVKNKGDNTQGHDERNEEDVPLLQTESSNTNGDVGLYSPGSYLFVAGDFNYRVSLARPGPNDHRKFPRPTEDISSPYHYSHLLAKDQLTQELQEQRTLQDLSEAPIKFLPTYKFVSPTHHPDLGGLFETWTWAKNRWPSWCDRILYRDVPSSTSAGQGGIEVHRYDALPIIPTSDHRPVALSVSVPLKPASAPAVFLPPFEIDPNWESKRRIARRKEVVVGVAAYLGLTREGNVLLLSIALGLTLGYFALQLFRAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.3
4 0.35
5 0.4
6 0.43
7 0.43
8 0.44
9 0.47
10 0.43
11 0.35
12 0.28
13 0.21
14 0.17
15 0.14
16 0.15
17 0.12
18 0.12
19 0.12
20 0.13
21 0.13
22 0.14
23 0.16
24 0.14
25 0.15
26 0.15
27 0.14
28 0.13
29 0.13
30 0.13
31 0.11
32 0.1
33 0.08
34 0.08
35 0.09
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.06
43 0.05
44 0.05
45 0.04
46 0.04
47 0.05
48 0.05
49 0.05
50 0.06
51 0.06
52 0.07
53 0.07
54 0.1
55 0.12
56 0.14
57 0.15
58 0.15
59 0.17
60 0.18
61 0.2
62 0.22
63 0.22
64 0.24
65 0.28
66 0.31
67 0.32
68 0.36
69 0.35
70 0.35
71 0.34
72 0.31
73 0.31
74 0.35
75 0.36
76 0.35
77 0.37
78 0.34
79 0.36
80 0.34
81 0.29
82 0.22
83 0.17
84 0.16
85 0.12
86 0.11
87 0.07
88 0.07
89 0.07
90 0.06
91 0.07
92 0.05
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.07
99 0.06
100 0.06
101 0.04
102 0.04
103 0.04
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.04
111 0.05
112 0.06
113 0.06
114 0.06
115 0.06
116 0.08
117 0.08
118 0.07
119 0.07
120 0.07
121 0.08
122 0.09
123 0.09
124 0.07
125 0.07
126 0.06
127 0.06
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.05
143 0.05
144 0.05
145 0.07
146 0.09
147 0.1
148 0.11
149 0.14
150 0.21
151 0.23
152 0.25
153 0.26
154 0.3
155 0.37
156 0.37
157 0.36
158 0.3
159 0.3
160 0.31
161 0.35
162 0.34
163 0.28
164 0.34
165 0.39
166 0.42
167 0.43
168 0.42
169 0.41
170 0.45
171 0.48
172 0.46
173 0.48
174 0.46
175 0.44
176 0.43
177 0.37
178 0.31
179 0.29
180 0.23
181 0.14
182 0.12
183 0.12
184 0.12
185 0.11
186 0.1
187 0.06
188 0.06
189 0.07
190 0.09
191 0.1
192 0.09
193 0.09
194 0.09
195 0.09
196 0.09
197 0.08
198 0.07
199 0.06
200 0.05
201 0.06
202 0.05
203 0.05
204 0.06
205 0.06
206 0.05
207 0.04
208 0.04
209 0.05
210 0.05
211 0.06
212 0.06
213 0.06
214 0.06
215 0.06
216 0.06
217 0.07
218 0.12
219 0.13
220 0.17
221 0.18
222 0.22
223 0.31
224 0.4
225 0.43
226 0.44
227 0.49
228 0.51
229 0.55
230 0.56
231 0.56
232 0.49
233 0.49
234 0.5
235 0.45
236 0.42
237 0.4
238 0.4
239 0.32
240 0.29
241 0.27
242 0.21
243 0.19
244 0.2
245 0.2
246 0.17
247 0.17
248 0.17
249 0.21
250 0.22
251 0.22
252 0.18
253 0.16
254 0.18
255 0.24
256 0.24
257 0.21
258 0.21
259 0.2
260 0.23
261 0.23
262 0.19
263 0.16
264 0.15
265 0.15
266 0.21
267 0.21
268 0.18
269 0.19
270 0.2
271 0.16
272 0.19
273 0.19
274 0.17
275 0.21
276 0.21
277 0.25
278 0.26
279 0.31
280 0.33
281 0.38
282 0.41
283 0.39
284 0.37
285 0.33
286 0.33
287 0.28
288 0.25
289 0.17
290 0.11
291 0.09
292 0.11
293 0.1
294 0.11
295 0.11
296 0.12
297 0.17
298 0.24
299 0.29
300 0.35
301 0.38
302 0.43
303 0.48
304 0.53
305 0.5
306 0.46
307 0.47
308 0.45
309 0.44
310 0.41
311 0.39
312 0.33
313 0.34
314 0.32
315 0.29
316 0.23
317 0.22
318 0.19
319 0.14
320 0.13
321 0.11
322 0.11
323 0.1
324 0.12
325 0.1
326 0.11
327 0.11
328 0.12
329 0.11
330 0.12
331 0.12
332 0.12
333 0.11
334 0.13
335 0.13
336 0.15
337 0.21
338 0.24
339 0.24
340 0.22
341 0.24
342 0.22
343 0.25
344 0.24
345 0.19
346 0.16
347 0.19
348 0.2
349 0.19
350 0.18
351 0.16
352 0.14
353 0.16
354 0.17
355 0.13
356 0.14
357 0.14
358 0.22
359 0.21
360 0.21
361 0.22
362 0.19
363 0.2
364 0.2
365 0.19
366 0.15
367 0.18
368 0.26
369 0.28
370 0.32
371 0.33
372 0.39
373 0.49
374 0.56
375 0.63
376 0.66
377 0.72
378 0.77
379 0.83
380 0.82
381 0.75
382 0.67
383 0.59
384 0.5
385 0.39
386 0.29
387 0.21
388 0.14
389 0.11
390 0.09
391 0.07
392 0.06
393 0.07
394 0.08
395 0.08
396 0.09
397 0.09
398 0.08
399 0.07
400 0.07
401 0.06
402 0.05
403 0.05
404 0.04
405 0.04
406 0.03
407 0.03
408 0.03
409 0.03
410 0.03
411 0.04
412 0.04
413 0.06