Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7SF16

Protein Details
Accession Q7SF16    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKNKGKGGKNRRRGKNENDNEKRELBasic
NLS Segment(s)
PositionSequence
3-16KNKGKGGKNRRRGK
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006196  RNA-binding_domain_S1_IF1  
IPR001253  TIF_eIF-1A  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0003725  F:double-stranded RNA binding  
GO:0033592  F:RNA strand annealing activity  
GO:0003743  F:translation initiation factor activity  
GO:0006413  P:translational initiation  
KEGG ncr:NCU07437  -  
Pfam View protein in Pfam  
PF01176  eIF-1a  
PROSITE View protein in PROSITE  
PS50832  S1_IF1_TYPE  
CDD cd05793  S1_IF1A  
Amino Acid Sequences MPKNKGKGGKNRRRGKNENDNEKRELTFKEEGQEYAQVIKMLGNGRLEAMCFDGVKRLGLIRGKLRKKIWINNGDIILVSLREYQDEKGDVILKYSADEARSLKAYGELPDTAKINETDTFGPNEDGDCGFEFDEDRDSEEEDGAEAGGKAVDIDDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.88
4 0.87
5 0.88
6 0.87
7 0.82
8 0.76
9 0.7
10 0.61
11 0.53
12 0.44
13 0.39
14 0.34
15 0.3
16 0.31
17 0.3
18 0.3
19 0.29
20 0.29
21 0.23
22 0.2
23 0.2
24 0.15
25 0.13
26 0.13
27 0.14
28 0.13
29 0.15
30 0.14
31 0.13
32 0.14
33 0.14
34 0.13
35 0.1
36 0.11
37 0.09
38 0.08
39 0.08
40 0.1
41 0.11
42 0.11
43 0.11
44 0.09
45 0.13
46 0.15
47 0.18
48 0.23
49 0.32
50 0.36
51 0.41
52 0.42
53 0.47
54 0.51
55 0.56
56 0.57
57 0.56
58 0.55
59 0.52
60 0.51
61 0.42
62 0.36
63 0.28
64 0.19
65 0.11
66 0.08
67 0.06
68 0.05
69 0.06
70 0.07
71 0.07
72 0.09
73 0.1
74 0.1
75 0.1
76 0.13
77 0.12
78 0.12
79 0.13
80 0.11
81 0.1
82 0.12
83 0.11
84 0.09
85 0.11
86 0.11
87 0.12
88 0.13
89 0.13
90 0.12
91 0.13
92 0.14
93 0.14
94 0.16
95 0.15
96 0.15
97 0.17
98 0.17
99 0.15
100 0.16
101 0.15
102 0.14
103 0.14
104 0.16
105 0.16
106 0.17
107 0.19
108 0.18
109 0.18
110 0.16
111 0.15
112 0.14
113 0.13
114 0.13
115 0.12
116 0.12
117 0.11
118 0.11
119 0.12
120 0.11
121 0.14
122 0.13
123 0.14
124 0.14
125 0.15
126 0.16
127 0.16
128 0.15
129 0.11
130 0.11
131 0.09
132 0.08
133 0.07
134 0.06
135 0.06
136 0.05
137 0.05