Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QVA2

Protein Details
Accession A0A1J9QVA2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-39NKELRAANAKQKRKRERHRTYISQGEGHydrophilic
NLS Segment(s)
PositionSequence
19-30ANAKQKRKRERH
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MAMHSAAILTRENKELRAANAKQKRKRERHRTYISQGEGLTIEEGMDRVRRGNEGKRGGIEQSEEQVQKRAARRCSKCNQVGHTARTCSQDIGSFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.29
4 0.36
5 0.38
6 0.43
7 0.51
8 0.6
9 0.63
10 0.71
11 0.77
12 0.78
13 0.86
14 0.87
15 0.88
16 0.89
17 0.9
18 0.88
19 0.84
20 0.81
21 0.72
22 0.63
23 0.52
24 0.42
25 0.32
26 0.24
27 0.18
28 0.09
29 0.07
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.07
37 0.09
38 0.12
39 0.18
40 0.26
41 0.29
42 0.3
43 0.3
44 0.31
45 0.3
46 0.27
47 0.24
48 0.17
49 0.14
50 0.18
51 0.17
52 0.17
53 0.2
54 0.21
55 0.24
56 0.3
57 0.35
58 0.4
59 0.5
60 0.55
61 0.61
62 0.67
63 0.72
64 0.73
65 0.73
66 0.69
67 0.69
68 0.7
69 0.67
70 0.65
71 0.59
72 0.55
73 0.52
74 0.48
75 0.39
76 0.34