Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5B3I6

Protein Details
Accession A0A2G5B3I6   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21CMWLPARKRSNKKLLTNSGNVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.333, mito 13, nucl 11.5, cyto_nucl 7.166
Family & Domain DBs
Amino Acid Sequences CMWLPARKRSNKKLLTNSGNVCSDVNTTRSIIDCASWMDRDAGTAAVRACNVEKRISKLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.81
3 0.78
4 0.72
5 0.65
6 0.57
7 0.48
8 0.38
9 0.29
10 0.24
11 0.18
12 0.16
13 0.13
14 0.12
15 0.12
16 0.12
17 0.12
18 0.1
19 0.09
20 0.08
21 0.09
22 0.1
23 0.1
24 0.1
25 0.11
26 0.1
27 0.11
28 0.11
29 0.1
30 0.09
31 0.11
32 0.11
33 0.11
34 0.11
35 0.12
36 0.13
37 0.18
38 0.2
39 0.26
40 0.3