Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5BHB1

Protein Details
Accession A0A2G5BHB1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-84SSTASTVRKREKKKEGREGTANHHydrophilic
NLS Segment(s)
PositionSequence
69-77RKREKKKEG
Subcellular Location(s) cyto 16, mito 8, cyto_nucl 8, cyto_pero 8
Family & Domain DBs
Amino Acid Sequences MLLSAGPDHADAAARPALGVGVAYRHQTSAVSTTAEPAVTMDASAVVLLPAPNSAGVFGADSSTASTVRKREKKKEGREGTANHGAPIEARFVDGFQVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.1
5 0.08
6 0.09
7 0.05
8 0.07
9 0.08
10 0.1
11 0.1
12 0.11
13 0.11
14 0.11
15 0.12
16 0.12
17 0.12
18 0.12
19 0.12
20 0.13
21 0.13
22 0.13
23 0.11
24 0.09
25 0.08
26 0.06
27 0.06
28 0.04
29 0.04
30 0.04
31 0.04
32 0.03
33 0.02
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.05
51 0.06
52 0.07
53 0.09
54 0.15
55 0.25
56 0.33
57 0.41
58 0.5
59 0.61
60 0.71
61 0.79
62 0.85
63 0.83
64 0.82
65 0.82
66 0.76
67 0.73
68 0.71
69 0.61
70 0.5
71 0.42
72 0.34
73 0.27
74 0.25
75 0.2
76 0.1
77 0.11
78 0.11
79 0.11
80 0.15