Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q1K4P1

Protein Details
Accession Q1K4P1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-83LRAVPKKKTSHMKKRHRQMAGKBasic
NLS Segment(s)
PositionSequence
66-79PKKKTSHMKKRHRQ
Subcellular Location(s) mito 18.5, cyto_mito 10.333, extr 3, plas 2, cyto_nucl 1.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncr:NCU03516  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAAMTAAAAAPAMRLFNPSTFFQTLRTQRFGVPALNFAVPAAAISLLPSIPSLLEDIWEGILRAVPKKKTSHMKKRHRQMAGKALKDVTHLNRCPACGNLKRMHHLCSTCLGKLKGFMDRNGGSNAKAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.13
4 0.17
5 0.18
6 0.23
7 0.25
8 0.25
9 0.27
10 0.34
11 0.4
12 0.42
13 0.44
14 0.39
15 0.38
16 0.41
17 0.4
18 0.35
19 0.28
20 0.24
21 0.23
22 0.22
23 0.2
24 0.16
25 0.14
26 0.09
27 0.08
28 0.06
29 0.04
30 0.03
31 0.04
32 0.04
33 0.04
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.05
40 0.04
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.05
47 0.04
48 0.06
49 0.06
50 0.09
51 0.13
52 0.14
53 0.18
54 0.21
55 0.27
56 0.36
57 0.46
58 0.54
59 0.61
60 0.71
61 0.76
62 0.84
63 0.87
64 0.84
65 0.8
66 0.76
67 0.76
68 0.73
69 0.66
70 0.57
71 0.5
72 0.42
73 0.38
74 0.35
75 0.31
76 0.31
77 0.31
78 0.34
79 0.34
80 0.35
81 0.35
82 0.33
83 0.34
84 0.32
85 0.38
86 0.4
87 0.43
88 0.5
89 0.5
90 0.51
91 0.5
92 0.45
93 0.4
94 0.4
95 0.4
96 0.35
97 0.39
98 0.36
99 0.31
100 0.35
101 0.35
102 0.37
103 0.36
104 0.36
105 0.37
106 0.38
107 0.4
108 0.4
109 0.38