Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5B8M4

Protein Details
Accession A0A2G5B8M4    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-36CTPIRQPPSRVKRTRSQTTGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000751  MPI_Phosphatase  
IPR001763  Rhodanese-like_dom  
IPR036873  Rhodanese-like_dom_sf  
Gene Ontology GO:0004725  F:protein tyrosine phosphatase activity  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
GO:1902751  P:positive regulation of cell cycle G2/M phase transition  
GO:0006470  P:protein dephosphorylation  
Pfam View protein in Pfam  
PF00581  Rhodanese  
PROSITE View protein in PROSITE  
PS50206  RHODANESE_3  
Amino Acid Sequences MRGTGLKSIGEDHMLDCTPIRQPPSRVKRTRSQTTGIPQFLPISEEGEQSEGGELFEANFSPSARSQPECHLLPCFTAPTDSIMRVDVETMGQLLAGGFKHMFDEQIVVDCRFPYEYEGGHIDGAVNAPTLEALEALLLGRTVNKRVVVVLHCEYSIQRAPSMASHLRRRDREVNMHRYPHLDYPEIYVLKGGYRNFFSFYKEKCQPQNYVEMNDRQYSVDCRQRMLQFNRQFKRTKSMNDAALGRSFSAAATVSGGQLFVANSMSPSMPQRSSSSSSLPARARRMGRTQSARPGINLIDFSQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.15
4 0.16
5 0.17
6 0.2
7 0.25
8 0.27
9 0.33
10 0.44
11 0.54
12 0.63
13 0.68
14 0.71
15 0.75
16 0.79
17 0.83
18 0.78
19 0.71
20 0.68
21 0.7
22 0.72
23 0.64
24 0.56
25 0.46
26 0.42
27 0.38
28 0.32
29 0.22
30 0.17
31 0.16
32 0.16
33 0.15
34 0.15
35 0.15
36 0.13
37 0.14
38 0.1
39 0.09
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.08
48 0.1
49 0.11
50 0.15
51 0.18
52 0.2
53 0.22
54 0.27
55 0.33
56 0.33
57 0.33
58 0.32
59 0.29
60 0.28
61 0.27
62 0.22
63 0.16
64 0.15
65 0.14
66 0.15
67 0.17
68 0.16
69 0.15
70 0.14
71 0.15
72 0.14
73 0.14
74 0.1
75 0.08
76 0.07
77 0.07
78 0.06
79 0.05
80 0.05
81 0.04
82 0.05
83 0.04
84 0.06
85 0.05
86 0.05
87 0.07
88 0.07
89 0.08
90 0.07
91 0.08
92 0.07
93 0.12
94 0.14
95 0.13
96 0.13
97 0.13
98 0.13
99 0.12
100 0.12
101 0.11
102 0.1
103 0.1
104 0.12
105 0.13
106 0.13
107 0.13
108 0.12
109 0.1
110 0.08
111 0.08
112 0.06
113 0.05
114 0.04
115 0.04
116 0.04
117 0.04
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.05
128 0.06
129 0.08
130 0.09
131 0.1
132 0.1
133 0.1
134 0.13
135 0.12
136 0.16
137 0.16
138 0.15
139 0.15
140 0.15
141 0.14
142 0.15
143 0.16
144 0.12
145 0.11
146 0.1
147 0.11
148 0.11
149 0.17
150 0.18
151 0.21
152 0.27
153 0.34
154 0.41
155 0.42
156 0.48
157 0.51
158 0.51
159 0.57
160 0.58
161 0.61
162 0.6
163 0.6
164 0.55
165 0.49
166 0.46
167 0.4
168 0.34
169 0.26
170 0.21
171 0.23
172 0.27
173 0.25
174 0.23
175 0.19
176 0.16
177 0.16
178 0.19
179 0.16
180 0.13
181 0.15
182 0.16
183 0.19
184 0.2
185 0.23
186 0.26
187 0.28
188 0.34
189 0.37
190 0.41
191 0.45
192 0.49
193 0.49
194 0.45
195 0.52
196 0.46
197 0.45
198 0.44
199 0.41
200 0.4
201 0.36
202 0.35
203 0.26
204 0.25
205 0.25
206 0.27
207 0.3
208 0.28
209 0.29
210 0.33
211 0.38
212 0.46
213 0.49
214 0.53
215 0.54
216 0.64
217 0.67
218 0.67
219 0.66
220 0.59
221 0.62
222 0.57
223 0.56
224 0.54
225 0.55
226 0.54
227 0.53
228 0.53
229 0.46
230 0.43
231 0.36
232 0.27
233 0.21
234 0.17
235 0.13
236 0.11
237 0.1
238 0.07
239 0.09
240 0.09
241 0.09
242 0.09
243 0.09
244 0.08
245 0.08
246 0.08
247 0.06
248 0.07
249 0.06
250 0.07
251 0.09
252 0.09
253 0.09
254 0.13
255 0.18
256 0.18
257 0.21
258 0.24
259 0.29
260 0.34
261 0.36
262 0.36
263 0.39
264 0.41
265 0.46
266 0.49
267 0.5
268 0.5
269 0.55
270 0.55
271 0.54
272 0.59
273 0.6
274 0.64
275 0.66
276 0.67
277 0.69
278 0.72
279 0.67
280 0.59
281 0.55
282 0.47
283 0.42
284 0.37