Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5B8L8

Protein Details
Accession A0A2G5B8L8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
116-143NRREDEYQDKRSRRKSHGRRQFYRESGTBasic
NLS Segment(s)
PositionSequence
127-131SRRKS
Subcellular Location(s) plas 20, E.R. 4, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006214  Bax_inhibitor_1-related  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01027  Bax1-I  
Amino Acid Sequences MALGMTIALFGSFSVAVMTSDRAQVVYGIGAVSYAVLSVSWVGLVNWFYPTRALSSLSIVLGLIMPCISVVLNTSNMLEQASIGMDIDPISHSLTFFNDLIRMFVHLIVLLSGENNRREDEYQDKRSRRKSHGRRQFYRESGTGFWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.08
5 0.1
6 0.1
7 0.11
8 0.11
9 0.11
10 0.11
11 0.11
12 0.1
13 0.08
14 0.07
15 0.06
16 0.05
17 0.05
18 0.05
19 0.04
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.05
31 0.06
32 0.07
33 0.09
34 0.09
35 0.09
36 0.1
37 0.11
38 0.11
39 0.12
40 0.13
41 0.12
42 0.13
43 0.14
44 0.13
45 0.13
46 0.1
47 0.09
48 0.07
49 0.07
50 0.05
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.02
57 0.04
58 0.05
59 0.06
60 0.06
61 0.06
62 0.06
63 0.07
64 0.07
65 0.06
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.03
72 0.03
73 0.04
74 0.04
75 0.04
76 0.05
77 0.06
78 0.06
79 0.06
80 0.06
81 0.08
82 0.1
83 0.1
84 0.1
85 0.11
86 0.11
87 0.11
88 0.11
89 0.12
90 0.09
91 0.1
92 0.09
93 0.08
94 0.08
95 0.07
96 0.07
97 0.05
98 0.05
99 0.08
100 0.11
101 0.14
102 0.15
103 0.16
104 0.19
105 0.2
106 0.24
107 0.32
108 0.38
109 0.45
110 0.54
111 0.6
112 0.66
113 0.75
114 0.79
115 0.79
116 0.81
117 0.81
118 0.83
119 0.87
120 0.89
121 0.88
122 0.88
123 0.88
124 0.83
125 0.78
126 0.7
127 0.64