FuNGI

A0A2G5BJ06

Protein Details

Accession

A0A2G5BJ06

Localization Confidence

Low

Confidence Score

9.3

NoLS Segment(s)

Position	Sequence	Protein Nature
30-57	TASVMWGARRSRRRRRARDLKRETLDSL	Hydrophilic

NLS Segment(s)

Position	Sequence
37-50	ARRSRRRRRARDLK

Subcellular Location(s)

mito 6, extr 5, mito_nucl 5, nucl 4, E.R. 4, cyto 3, plas 3

Family & Domain DBs

InterPro	View protein in InterPro IPR045886 ThiF/MoeB/HesA IPR000594 ThiF_NAD_FAD-bd IPR035985 Ubiquitin-activating_enz
Gene Ontology	GO:0016020 C:membrane GO:0008641 F:ubiquitin-like modifier activating enzyme activity
Pfam	View protein in Pfam PF00899 ThiF
CDD	cd00755 YgdL_like

Amino Acid Sequences

MTAYMERLSRVFSDNRMQLVATALVASAATASVMWGARRSRRRRRARDLKRETLDSLLFDSDYDTLSDSGSGNNEAVDKHTPVALTPNEESLFQEQLARHYAFFGQEGMARLRDSFVVVVGAGGVGSWAAMMLLRSGVQRIRIIDFDQVTLSSLNRHVAATRGTVGISKVEALKRSFLEIVPHAKIEACVALFSAAAASNLLSGEPDYVLDCIDNMDTKLELLNYCRNNDLQVISAMGAGMKSDPSRVQIADIGDTFEDPMSRAVRRRLKALGIQSGIKVVYSSEKPGKVQLLSLSESQKEDPGDFSVLPDFRVRIVPVLGTMPAMFGIAMGTHVLTELAGFPTEPLAVKGRHALYTRLQRDLGNREYAVSAEHGGPQLHMSTDDCGYMLEEIWRGKSAISGATDRLALTRWRRSQPMSTSNCVCMTKAEADKHDKLDCAPEEYYSPDTVKFIERRLEEEKHLSTMR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.36
2	0.38
3	0.36
4	0.34
5	0.3
6	0.3
7	0.25
8	0.16
9	0.13
10	0.1
11	0.09
12	0.09
13	0.08
14	0.05
15	0.04
16	0.04
17	0.03
18	0.04
19	0.06
20	0.08
21	0.09
22	0.13
23	0.19
24	0.28
25	0.38
26	0.49
27	0.58
28	0.67
29	0.78
30	0.84
31	0.9
32	0.93
33	0.94
34	0.95
35	0.94
36	0.94
37	0.89
38	0.82
39	0.73
40	0.67
41	0.57
42	0.46
43	0.39
44	0.29
45	0.23
46	0.18
47	0.18
48	0.13
49	0.12
50	0.11
51	0.1
52	0.09
53	0.09
54	0.1
55	0.09
56	0.1
57	0.11
58	0.12
59	0.1
60	0.1
61	0.11
62	0.1
63	0.13
64	0.15
65	0.15
66	0.15
67	0.16
68	0.15
69	0.15
70	0.21
71	0.2
72	0.21
73	0.21
74	0.24
75	0.23
76	0.23
77	0.25
78	0.21
79	0.21
80	0.16
81	0.2
82	0.16
83	0.19
84	0.24
85	0.22
86	0.2
87	0.19
88	0.21
89	0.18
90	0.18
91	0.16
92	0.11
93	0.13
94	0.15
95	0.16
96	0.16
97	0.15
98	0.14
99	0.14
100	0.14
101	0.13
102	0.1
103	0.09
104	0.08
105	0.07
106	0.07
107	0.06
108	0.05
109	0.04
110	0.03
111	0.03
112	0.02
113	0.02
114	0.02
115	0.02
116	0.02
117	0.02
118	0.03
119	0.03
120	0.04
121	0.05
122	0.05
123	0.07
124	0.09
125	0.11
126	0.13
127	0.15
128	0.17
129	0.17
130	0.19
131	0.21
132	0.21
133	0.19
134	0.17
135	0.15
136	0.14
137	0.13
138	0.12
139	0.1
140	0.1
141	0.11
142	0.11
143	0.11
144	0.1
145	0.12
146	0.13
147	0.13
148	0.13
149	0.12
150	0.12
151	0.12
152	0.12
153	0.11
154	0.09
155	0.09
156	0.11
157	0.12
158	0.16
159	0.16
160	0.18
161	0.18
162	0.2
163	0.2
164	0.17
165	0.19
166	0.19
167	0.23
168	0.21
169	0.21
170	0.19
171	0.18
172	0.17
173	0.14
174	0.12
175	0.07
176	0.06
177	0.06
178	0.06
179	0.06
180	0.05
181	0.05
182	0.04
183	0.04
184	0.04
185	0.04
186	0.04
187	0.04
188	0.04
189	0.04
190	0.04
191	0.04
192	0.04
193	0.04
194	0.04
195	0.04
196	0.05
197	0.04
198	0.04
199	0.04
200	0.05
201	0.05
202	0.05
203	0.05
204	0.05
205	0.05
206	0.06
207	0.06
208	0.06
209	0.08
210	0.15
211	0.16
212	0.17
213	0.18
214	0.17
215	0.18
216	0.18
217	0.16
218	0.11
219	0.09
220	0.09
221	0.08
222	0.08
223	0.07
224	0.06
225	0.05
226	0.04
227	0.04
228	0.04
229	0.04
230	0.05
231	0.06
232	0.08
233	0.09
234	0.09
235	0.1
236	0.12
237	0.13
238	0.13
239	0.13
240	0.11
241	0.1
242	0.1
243	0.09
244	0.06
245	0.06
246	0.05
247	0.07
248	0.08
249	0.1
250	0.13
251	0.21
252	0.29
253	0.3
254	0.33
255	0.34
256	0.35
257	0.39
258	0.4
259	0.38
260	0.32
261	0.32
262	0.28
263	0.27
264	0.23
265	0.18
266	0.13
267	0.08
268	0.1
269	0.1
270	0.14
271	0.18
272	0.19
273	0.2
274	0.22
275	0.25
276	0.21
277	0.22
278	0.21
279	0.19
280	0.2
281	0.22
282	0.22
283	0.2
284	0.21
285	0.2
286	0.19
287	0.17
288	0.15
289	0.13
290	0.13
291	0.14
292	0.13
293	0.13
294	0.15
295	0.14
296	0.15
297	0.15
298	0.13
299	0.12
300	0.15
301	0.14
302	0.12
303	0.12
304	0.11
305	0.11
306	0.12
307	0.11
308	0.09
309	0.08
310	0.07
311	0.06
312	0.06
313	0.05
314	0.04
315	0.04
316	0.03
317	0.04
318	0.04
319	0.04
320	0.03
321	0.04
322	0.04
323	0.03
324	0.04
325	0.05
326	0.05
327	0.05
328	0.05
329	0.05
330	0.06
331	0.07
332	0.07
333	0.08
334	0.11
335	0.12
336	0.13
337	0.18
338	0.19
339	0.24
340	0.25
341	0.27
342	0.31
343	0.41
344	0.43
345	0.41
346	0.4
347	0.38
348	0.42
349	0.46
350	0.43
351	0.37
352	0.34
353	0.31
354	0.3
355	0.28
356	0.23
357	0.17
358	0.15
359	0.11
360	0.13
361	0.13
362	0.13
363	0.13
364	0.13
365	0.13
366	0.11
367	0.12
368	0.11
369	0.11
370	0.12
371	0.12
372	0.11
373	0.1
374	0.1
375	0.1
376	0.09
377	0.09
378	0.11
379	0.11
380	0.13
381	0.14
382	0.14
383	0.13
384	0.14
385	0.14
386	0.16
387	0.18
388	0.19
389	0.19
390	0.2
391	0.2
392	0.18
393	0.18
394	0.16
395	0.19
396	0.24
397	0.33
398	0.39
399	0.44
400	0.49
401	0.54
402	0.6
403	0.63
404	0.67
405	0.63
406	0.62
407	0.6
408	0.59
409	0.58
410	0.5
411	0.41
412	0.33
413	0.31
414	0.32
415	0.35
416	0.37
417	0.39
418	0.47
419	0.51
420	0.54
421	0.52
422	0.45
423	0.4
424	0.44
425	0.39
426	0.36
427	0.32
428	0.28
429	0.27
430	0.3
431	0.31
432	0.25
433	0.25
434	0.2
435	0.21
436	0.22
437	0.28
438	0.27
439	0.29
440	0.35
441	0.35
442	0.39
443	0.45
444	0.48
445	0.46
446	0.5
447	0.48

A0A2G5BJ06

3D AlphaFold-predicted Structure Viewer