Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5BIL7

Protein Details
Accession A0A2G5BIL7    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-80DAENKDGAAKKKKNKKRNKKKKKKSGAGAAGQSEBasic
NLS Segment(s)
PositionSequence
54-72AAKKKKNKKRNKKKKKKSG
Subcellular Location(s) cyto_nucl 15.333, nucl 13.5, cyto 13, mito_nucl 7.832
Family & Domain DBs
InterPro View protein in InterPro  
IPR036005  Creatinase/aminopeptidase-like  
IPR000994  Pept_M24  
IPR001714  Pept_M24_MAP  
IPR002468  Pept_M24A_MAP2  
IPR018349  Pept_M24A_MAP2_BS  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0046872  F:metal ion binding  
GO:0070006  F:metalloaminopeptidase activity  
GO:0070084  P:protein initiator methionine removal  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00557  Peptidase_M24  
PROSITE View protein in PROSITE  
PS01202  MAP_2  
CDD cd01088  MetAP2  
Amino Acid Sequences MTTVDGSANAASAIEKGVGKLSVSKETPITKNTTNDSDEGGDSAEEDAENKDGAAKKKKNKKRNKKKKKKSGAGAAGQSETLSVPVSQLFPNNSYPVGEISEYVDDNKYRTTSEEMRAKDRLNEQQLFDLRRAAEVHREVRKNVRQRIKPGMDLTTIAEMIENGTRSLVEVNGLEAGIGFPTGLSINHCAAHFTPNAGDHVVLQQDDVLKVDFGVQVNGNIVDSAFTMSWNPRYDPLLQAVKEATNTGVREAGIDVRLGDIGAAIQEVMESYEIELDGKTTHIKPIRNLCGHNIGPYLIHSGKSVPIVANHDQTRMEEGELFAIETFGSTGNGYVLEEGACSHYAKIGGEHAKPRIPSAKKLLQTITKNFGTLPFCRRYLDRLGESHYYLGLKSLVDSGIVNAYPPLCDVKGSYTAQSEHTFILRPTVKEVLSRGEDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.12
5 0.13
6 0.13
7 0.19
8 0.21
9 0.27
10 0.28
11 0.29
12 0.32
13 0.38
14 0.42
15 0.4
16 0.43
17 0.4
18 0.44
19 0.47
20 0.48
21 0.44
22 0.41
23 0.4
24 0.36
25 0.31
26 0.26
27 0.22
28 0.15
29 0.13
30 0.13
31 0.1
32 0.07
33 0.08
34 0.08
35 0.09
36 0.09
37 0.08
38 0.13
39 0.18
40 0.26
41 0.35
42 0.43
43 0.52
44 0.63
45 0.74
46 0.8
47 0.86
48 0.9
49 0.91
50 0.94
51 0.95
52 0.96
53 0.97
54 0.98
55 0.98
56 0.97
57 0.95
58 0.95
59 0.93
60 0.89
61 0.83
62 0.74
63 0.63
64 0.52
65 0.42
66 0.31
67 0.21
68 0.14
69 0.09
70 0.07
71 0.06
72 0.08
73 0.1
74 0.1
75 0.14
76 0.15
77 0.17
78 0.2
79 0.21
80 0.2
81 0.19
82 0.19
83 0.17
84 0.17
85 0.14
86 0.12
87 0.13
88 0.15
89 0.14
90 0.15
91 0.16
92 0.14
93 0.15
94 0.16
95 0.15
96 0.13
97 0.15
98 0.2
99 0.24
100 0.31
101 0.37
102 0.38
103 0.42
104 0.45
105 0.43
106 0.42
107 0.43
108 0.43
109 0.44
110 0.45
111 0.41
112 0.44
113 0.48
114 0.45
115 0.39
116 0.34
117 0.27
118 0.25
119 0.26
120 0.2
121 0.23
122 0.26
123 0.32
124 0.37
125 0.39
126 0.39
127 0.47
128 0.54
129 0.56
130 0.6
131 0.62
132 0.61
133 0.65
134 0.73
135 0.68
136 0.64
137 0.58
138 0.51
139 0.42
140 0.37
141 0.32
142 0.23
143 0.19
144 0.14
145 0.11
146 0.08
147 0.08
148 0.09
149 0.08
150 0.06
151 0.06
152 0.06
153 0.07
154 0.07
155 0.06
156 0.06
157 0.05
158 0.06
159 0.06
160 0.06
161 0.05
162 0.05
163 0.05
164 0.04
165 0.03
166 0.03
167 0.02
168 0.03
169 0.03
170 0.04
171 0.05
172 0.08
173 0.09
174 0.1
175 0.11
176 0.11
177 0.12
178 0.15
179 0.13
180 0.12
181 0.12
182 0.11
183 0.12
184 0.12
185 0.11
186 0.08
187 0.09
188 0.09
189 0.08
190 0.07
191 0.07
192 0.07
193 0.07
194 0.08
195 0.06
196 0.05
197 0.05
198 0.07
199 0.07
200 0.07
201 0.08
202 0.07
203 0.07
204 0.08
205 0.08
206 0.07
207 0.05
208 0.05
209 0.04
210 0.04
211 0.05
212 0.04
213 0.05
214 0.06
215 0.07
216 0.11
217 0.12
218 0.13
219 0.13
220 0.15
221 0.17
222 0.17
223 0.21
224 0.23
225 0.22
226 0.22
227 0.21
228 0.19
229 0.18
230 0.17
231 0.13
232 0.11
233 0.11
234 0.1
235 0.11
236 0.1
237 0.1
238 0.11
239 0.11
240 0.08
241 0.08
242 0.08
243 0.07
244 0.07
245 0.06
246 0.05
247 0.04
248 0.03
249 0.03
250 0.03
251 0.02
252 0.02
253 0.02
254 0.02
255 0.03
256 0.03
257 0.03
258 0.04
259 0.04
260 0.04
261 0.05
262 0.05
263 0.05
264 0.05
265 0.06
266 0.08
267 0.08
268 0.14
269 0.19
270 0.21
271 0.26
272 0.36
273 0.44
274 0.45
275 0.46
276 0.44
277 0.47
278 0.45
279 0.42
280 0.33
281 0.24
282 0.21
283 0.2
284 0.22
285 0.15
286 0.15
287 0.13
288 0.14
289 0.15
290 0.16
291 0.16
292 0.11
293 0.13
294 0.18
295 0.21
296 0.26
297 0.25
298 0.26
299 0.25
300 0.25
301 0.26
302 0.22
303 0.2
304 0.14
305 0.14
306 0.13
307 0.13
308 0.13
309 0.09
310 0.08
311 0.07
312 0.06
313 0.06
314 0.05
315 0.05
316 0.05
317 0.05
318 0.05
319 0.06
320 0.06
321 0.06
322 0.06
323 0.05
324 0.05
325 0.06
326 0.07
327 0.08
328 0.09
329 0.09
330 0.1
331 0.11
332 0.12
333 0.12
334 0.18
335 0.22
336 0.25
337 0.3
338 0.32
339 0.35
340 0.35
341 0.38
342 0.4
343 0.39
344 0.41
345 0.46
346 0.5
347 0.5
348 0.54
349 0.56
350 0.55
351 0.58
352 0.57
353 0.56
354 0.48
355 0.45
356 0.41
357 0.41
358 0.36
359 0.34
360 0.35
361 0.33
362 0.34
363 0.36
364 0.37
365 0.37
366 0.42
367 0.45
368 0.43
369 0.41
370 0.45
371 0.46
372 0.46
373 0.41
374 0.34
375 0.27
376 0.22
377 0.2
378 0.16
379 0.12
380 0.12
381 0.13
382 0.11
383 0.11
384 0.12
385 0.11
386 0.13
387 0.13
388 0.12
389 0.12
390 0.12
391 0.11
392 0.12
393 0.15
394 0.12
395 0.13
396 0.14
397 0.18
398 0.25
399 0.26
400 0.28
401 0.28
402 0.3
403 0.33
404 0.34
405 0.31
406 0.26
407 0.25
408 0.25
409 0.21
410 0.29
411 0.3
412 0.29
413 0.32
414 0.35
415 0.34
416 0.35
417 0.38
418 0.36