Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BIW1

Protein Details
Accession A0A2G5BIW1    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
89-114SESLTPQQRQRKSQRQKIQQSSCLYSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MPKVVLEHDSEAVQCPTPLNSSDLLQFLPASRSSSTLAIDIDAQAFFIDPTTTEQEQMGVAGLSPPETRNNSTHTSPTTQPADIDLNLSESLTPQQRQRKSQRQKIQQSSCLYSPTTGSRNSKAPTAESSVDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.14
4 0.15
5 0.16
6 0.15
7 0.15
8 0.16
9 0.18
10 0.18
11 0.16
12 0.14
13 0.13
14 0.12
15 0.13
16 0.13
17 0.13
18 0.13
19 0.15
20 0.16
21 0.17
22 0.17
23 0.16
24 0.15
25 0.12
26 0.12
27 0.11
28 0.1
29 0.08
30 0.07
31 0.06
32 0.06
33 0.05
34 0.05
35 0.04
36 0.04
37 0.08
38 0.13
39 0.13
40 0.14
41 0.14
42 0.14
43 0.14
44 0.13
45 0.1
46 0.05
47 0.04
48 0.04
49 0.04
50 0.05
51 0.05
52 0.06
53 0.08
54 0.11
55 0.13
56 0.14
57 0.19
58 0.21
59 0.23
60 0.24
61 0.24
62 0.25
63 0.24
64 0.27
65 0.25
66 0.22
67 0.21
68 0.21
69 0.2
70 0.17
71 0.17
72 0.12
73 0.12
74 0.12
75 0.11
76 0.09
77 0.07
78 0.1
79 0.13
80 0.15
81 0.19
82 0.29
83 0.34
84 0.44
85 0.53
86 0.62
87 0.69
88 0.78
89 0.82
90 0.83
91 0.89
92 0.9
93 0.88
94 0.85
95 0.8
96 0.75
97 0.66
98 0.58
99 0.48
100 0.38
101 0.32
102 0.3
103 0.27
104 0.29
105 0.32
106 0.34
107 0.4
108 0.41
109 0.43
110 0.39
111 0.39
112 0.37
113 0.39
114 0.37