Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5B7Z3

Protein Details
Accession A0A2G5B7Z3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
4-29TTLTRGGRVYAKKRKAKRAQVEEVVFHydrophilic
NLS Segment(s)
PositionSequence
14-21AKKRKAKR
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019186  Nucleolar_protein_12  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09805  Nop25  
Amino Acid Sequences NNSTTLTRGGRVYAKKRKAKRAQVEEVVFDPTARHSFLTGFHKRKVQRREHAVAEAKAYERQEKLDMRRERREQLKDQFTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.65
3 0.73
4 0.8
5 0.83
6 0.86
7 0.86
8 0.86
9 0.84
10 0.83
11 0.76
12 0.67
13 0.57
14 0.49
15 0.38
16 0.28
17 0.2
18 0.13
19 0.13
20 0.11
21 0.1
22 0.08
23 0.09
24 0.13
25 0.21
26 0.28
27 0.3
28 0.31
29 0.37
30 0.42
31 0.49
32 0.55
33 0.56
34 0.57
35 0.62
36 0.65
37 0.62
38 0.65
39 0.62
40 0.53
41 0.45
42 0.38
43 0.3
44 0.28
45 0.27
46 0.24
47 0.19
48 0.2
49 0.24
50 0.29
51 0.35
52 0.42
53 0.49
54 0.53
55 0.62
56 0.66
57 0.69
58 0.72
59 0.74
60 0.73
61 0.75