Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5B2U4

Protein Details
Accession A0A2G5B2U4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGKSIRSKSKIRNRNALRVTHydrophilic
76-105ALSGKSTKSKKRGKHAKPRRGVVRNSKGRVBasic
NLS Segment(s)
PositionSequence
80-116KSTKSKKRGKHAKPRRGVVRNSKGRVQTRNAIKWVKN
Subcellular Location(s) mito 17.5, mito_nucl 13, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MGKSIRSKSKIRNRNALRVTVFGPKEAERIQRLAAKQRVSTGSTADLMETDQIPLTTTEDTVDTSTSDVEMNTGEALSGKSTKSKKRGKHAKPRRGVVRNSKGRVQTRNAIKWVKNKTFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.77
3 0.74
4 0.65
5 0.58
6 0.53
7 0.5
8 0.44
9 0.34
10 0.33
11 0.26
12 0.28
13 0.28
14 0.31
15 0.25
16 0.27
17 0.28
18 0.3
19 0.32
20 0.37
21 0.39
22 0.37
23 0.35
24 0.37
25 0.37
26 0.34
27 0.32
28 0.24
29 0.21
30 0.19
31 0.18
32 0.13
33 0.11
34 0.09
35 0.09
36 0.08
37 0.06
38 0.05
39 0.05
40 0.06
41 0.06
42 0.07
43 0.06
44 0.06
45 0.06
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.07
66 0.07
67 0.13
68 0.19
69 0.26
70 0.36
71 0.44
72 0.51
73 0.61
74 0.72
75 0.76
76 0.82
77 0.86
78 0.87
79 0.88
80 0.89
81 0.89
82 0.86
83 0.84
84 0.84
85 0.83
86 0.83
87 0.78
88 0.75
89 0.73
90 0.72
91 0.7
92 0.65
93 0.63
94 0.63
95 0.66
96 0.67
97 0.66
98 0.65
99 0.67
100 0.71