Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5B0Q7

Protein Details
Accession A0A2G5B0Q7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
11-30RSCMWLPARKRSNKKLLTNSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, mito_nucl 14, nucl 8
Family & Domain DBs
Amino Acid Sequences MARNKQSITTRSCMWLPARKRSNKKLLTNSGNVCSDVNTTHSIIDCALWMDRDAGVAFKKKNTAFLHVRRPPYERV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.4
4 0.46
5 0.54
6 0.59
7 0.68
8 0.73
9 0.78
10 0.78
11 0.81
12 0.8
13 0.8
14 0.76
15 0.73
16 0.67
17 0.6
18 0.51
19 0.43
20 0.33
21 0.25
22 0.19
23 0.14
24 0.13
25 0.11
26 0.1
27 0.1
28 0.1
29 0.1
30 0.09
31 0.09
32 0.07
33 0.06
34 0.06
35 0.06
36 0.06
37 0.07
38 0.07
39 0.07
40 0.07
41 0.08
42 0.11
43 0.16
44 0.17
45 0.18
46 0.25
47 0.25
48 0.33
49 0.35
50 0.4
51 0.45
52 0.52
53 0.6
54 0.61
55 0.68
56 0.63