Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BEQ5

Protein Details
Accession A0A2G5BEQ5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
239-258YTKLQHKRAKILKYLKRKSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR000589  Ribosomal_S15  
IPR005290  Ribosomal_S15_bac-type  
IPR009068  S15_NS1_RNA-bd  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00312  Ribosomal_S15  
CDD cd00353  Ribosomal_S15p_S13e  
Amino Acid Sequences MYCTSRGILGAVRAATGTVAAPSRAMHTTTAVQVRRRSNRKAELAAARVAEAEAARRAEEQLRKLKDTRFLNSLEKPDRLFDSTQITQRDAAAEVAAGQQGGVEQDKIGKQGGEKVRRKADSGKYACLVKPSEIELVTTVGPKAEQSMNRGFSLNFMHESTDGNPSVQSDIVRRVVALENSNAKGVSQYNINTAVEMFGRSEGDSGSPEVQAAVWTVRINQLEDHLRANHKDHQNRRAYTKLQHKRAKILKYLKRKSLERYYVCLKQLGLTKDMVVGEILIPKRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.11
4 0.09
5 0.08
6 0.09
7 0.09
8 0.09
9 0.1
10 0.13
11 0.15
12 0.16
13 0.14
14 0.16
15 0.19
16 0.24
17 0.32
18 0.33
19 0.36
20 0.42
21 0.51
22 0.58
23 0.63
24 0.65
25 0.67
26 0.72
27 0.74
28 0.72
29 0.7
30 0.67
31 0.63
32 0.58
33 0.48
34 0.39
35 0.32
36 0.26
37 0.2
38 0.12
39 0.11
40 0.11
41 0.12
42 0.12
43 0.12
44 0.15
45 0.2
46 0.25
47 0.3
48 0.36
49 0.4
50 0.44
51 0.47
52 0.49
53 0.51
54 0.51
55 0.48
56 0.43
57 0.42
58 0.44
59 0.45
60 0.49
61 0.45
62 0.42
63 0.38
64 0.37
65 0.36
66 0.33
67 0.29
68 0.23
69 0.26
70 0.27
71 0.32
72 0.31
73 0.3
74 0.27
75 0.27
76 0.25
77 0.19
78 0.16
79 0.1
80 0.08
81 0.08
82 0.07
83 0.07
84 0.06
85 0.04
86 0.04
87 0.04
88 0.05
89 0.05
90 0.04
91 0.04
92 0.07
93 0.08
94 0.09
95 0.1
96 0.09
97 0.09
98 0.17
99 0.25
100 0.33
101 0.38
102 0.43
103 0.49
104 0.5
105 0.52
106 0.52
107 0.52
108 0.52
109 0.5
110 0.47
111 0.42
112 0.42
113 0.4
114 0.35
115 0.29
116 0.19
117 0.17
118 0.16
119 0.16
120 0.14
121 0.14
122 0.11
123 0.12
124 0.11
125 0.1
126 0.08
127 0.06
128 0.06
129 0.06
130 0.07
131 0.09
132 0.1
133 0.14
134 0.19
135 0.21
136 0.22
137 0.23
138 0.2
139 0.19
140 0.2
141 0.17
142 0.13
143 0.12
144 0.12
145 0.11
146 0.13
147 0.13
148 0.15
149 0.14
150 0.12
151 0.12
152 0.12
153 0.12
154 0.12
155 0.11
156 0.09
157 0.12
158 0.14
159 0.14
160 0.13
161 0.14
162 0.16
163 0.17
164 0.17
165 0.16
166 0.18
167 0.19
168 0.2
169 0.17
170 0.15
171 0.14
172 0.14
173 0.12
174 0.11
175 0.12
176 0.13
177 0.16
178 0.16
179 0.15
180 0.14
181 0.13
182 0.11
183 0.1
184 0.09
185 0.07
186 0.08
187 0.07
188 0.08
189 0.07
190 0.08
191 0.08
192 0.1
193 0.1
194 0.09
195 0.09
196 0.09
197 0.09
198 0.08
199 0.08
200 0.07
201 0.07
202 0.08
203 0.09
204 0.13
205 0.14
206 0.15
207 0.14
208 0.19
209 0.22
210 0.24
211 0.26
212 0.25
213 0.28
214 0.29
215 0.33
216 0.37
217 0.41
218 0.49
219 0.54
220 0.61
221 0.67
222 0.68
223 0.7
224 0.68
225 0.64
226 0.63
227 0.66
228 0.67
229 0.68
230 0.72
231 0.7
232 0.73
233 0.76
234 0.75
235 0.73
236 0.74
237 0.73
238 0.76
239 0.81
240 0.79
241 0.79
242 0.77
243 0.76
244 0.77
245 0.78
246 0.71
247 0.69
248 0.68
249 0.67
250 0.63
251 0.57
252 0.46
253 0.41
254 0.43
255 0.39
256 0.34
257 0.28
258 0.27
259 0.28
260 0.27
261 0.23
262 0.16
263 0.13
264 0.12
265 0.17