Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5B400

Protein Details
Accession A0A2G5B400    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
22-44RIPWRMSKTRKANVRKRLREVDSHydrophilic
82-101RTAKNHRKSVHKVPHFTKRPBasic
NLS Segment(s)
PositionSequence
29-37KTRKANVRK
Subcellular Location(s) mito 21, cyto_mito 11.833, mito_nucl 11.833, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGSFVGAFKPSLVAFGGRAWRIPWRMSKTRKANVRKRLREVDSVIDTLMASGVQCKQLDLIKDMPRESEMLPRDKYTTFSRTAKNHRKSVHKVPHFTKRPIPRTTPKSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.14
4 0.2
5 0.18
6 0.19
7 0.19
8 0.24
9 0.26
10 0.29
11 0.34
12 0.37
13 0.46
14 0.52
15 0.61
16 0.65
17 0.7
18 0.75
19 0.77
20 0.78
21 0.79
22 0.83
23 0.81
24 0.8
25 0.81
26 0.75
27 0.7
28 0.63
29 0.58
30 0.5
31 0.42
32 0.34
33 0.25
34 0.21
35 0.15
36 0.12
37 0.06
38 0.03
39 0.04
40 0.05
41 0.07
42 0.07
43 0.07
44 0.08
45 0.1
46 0.12
47 0.14
48 0.19
49 0.22
50 0.24
51 0.24
52 0.23
53 0.22
54 0.23
55 0.21
56 0.22
57 0.2
58 0.24
59 0.25
60 0.26
61 0.28
62 0.26
63 0.29
64 0.27
65 0.28
66 0.29
67 0.33
68 0.38
69 0.44
70 0.54
71 0.61
72 0.64
73 0.67
74 0.68
75 0.73
76 0.74
77 0.77
78 0.77
79 0.75
80 0.76
81 0.75
82 0.8
83 0.78
84 0.75
85 0.74
86 0.73
87 0.73
88 0.71
89 0.73
90 0.73