Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5B2W6

Protein Details
Accession A0A2G5B2W6   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
29-50RLAPLRFSKKQLQHQAQRREILHydrophilic
NLS Segment(s)
PositionSequence
241-246IRRKRR
Subcellular Location(s) nucl 11, cyto_nucl 10.5, mito 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006939  SNF5  
Gene Ontology GO:0000228  C:nuclear chromosome  
GO:0070603  C:SWI/SNF superfamily-type complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF04855  SNF5  
Amino Acid Sequences MHAPGSGRQHTNAPVTIVLPDQRHVAPGRLAPLRFSKKQLQHQAQRREILVPIRLDIDADGYRLRDTFTWDLNNELIAPRQFAMCLCSDMELPAESFVMLIVQAIDEQLDDYARYAQAFDEDELRVVIRIDIIIGHIALRDQLEWDVAPLLRPLRVAHVLCAEKRLGGDFETSIAHAIREQLYAYAKSFLLADDMELARTVLPPVTTVIRDTVHSQTFSPLIAHLHTVDAERMEKDADREIRRKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.25
4 0.23
5 0.23
6 0.2
7 0.19
8 0.21
9 0.2
10 0.23
11 0.24
12 0.24
13 0.23
14 0.24
15 0.29
16 0.31
17 0.31
18 0.31
19 0.39
20 0.44
21 0.43
22 0.47
23 0.5
24 0.54
25 0.64
26 0.71
27 0.72
28 0.74
29 0.81
30 0.85
31 0.82
32 0.76
33 0.67
34 0.58
35 0.51
36 0.46
37 0.41
38 0.31
39 0.26
40 0.24
41 0.23
42 0.21
43 0.17
44 0.17
45 0.12
46 0.12
47 0.12
48 0.11
49 0.12
50 0.12
51 0.13
52 0.09
53 0.15
54 0.17
55 0.2
56 0.23
57 0.23
58 0.24
59 0.24
60 0.23
61 0.17
62 0.15
63 0.14
64 0.11
65 0.12
66 0.1
67 0.1
68 0.1
69 0.09
70 0.11
71 0.09
72 0.1
73 0.09
74 0.1
75 0.1
76 0.1
77 0.1
78 0.08
79 0.08
80 0.07
81 0.06
82 0.05
83 0.05
84 0.05
85 0.04
86 0.03
87 0.03
88 0.03
89 0.02
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.07
105 0.08
106 0.07
107 0.09
108 0.08
109 0.09
110 0.08
111 0.08
112 0.07
113 0.06
114 0.06
115 0.04
116 0.04
117 0.03
118 0.03
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.05
129 0.05
130 0.05
131 0.05
132 0.06
133 0.07
134 0.06
135 0.07
136 0.07
137 0.08
138 0.08
139 0.09
140 0.09
141 0.12
142 0.17
143 0.17
144 0.17
145 0.23
146 0.25
147 0.24
148 0.26
149 0.22
150 0.18
151 0.17
152 0.18
153 0.12
154 0.11
155 0.12
156 0.1
157 0.11
158 0.1
159 0.1
160 0.1
161 0.09
162 0.08
163 0.07
164 0.09
165 0.09
166 0.09
167 0.1
168 0.11
169 0.13
170 0.15
171 0.15
172 0.15
173 0.14
174 0.14
175 0.14
176 0.12
177 0.11
178 0.09
179 0.09
180 0.1
181 0.1
182 0.1
183 0.1
184 0.1
185 0.09
186 0.09
187 0.1
188 0.07
189 0.07
190 0.08
191 0.1
192 0.13
193 0.13
194 0.14
195 0.16
196 0.16
197 0.17
198 0.2
199 0.24
200 0.25
201 0.25
202 0.25
203 0.25
204 0.24
205 0.24
206 0.2
207 0.16
208 0.14
209 0.14
210 0.15
211 0.13
212 0.14
213 0.14
214 0.15
215 0.15
216 0.15
217 0.16
218 0.15
219 0.15
220 0.16
221 0.17
222 0.18
223 0.25
224 0.31
225 0.37
226 0.45