Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5B3E2

Protein Details
Accession A0A2G5B3E2    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-32TTRSCMWLPTRKRSNKKLLTNSGNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 14.5, mito 14, nucl 13
Family & Domain DBs
Amino Acid Sequences MARNKQSITTRSCMWLPTRKRSNKKLLTNSGNVCSNVNTTRSNIDCALWIDRDAGVAFKKKNTAFLHVRRPLYERV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.42
4 0.48
5 0.56
6 0.62
7 0.7
8 0.76
9 0.81
10 0.81
11 0.84
12 0.83
13 0.82
14 0.78
15 0.75
16 0.69
17 0.61
18 0.54
19 0.44
20 0.35
21 0.26
22 0.23
23 0.18
24 0.17
25 0.15
26 0.13
27 0.16
28 0.16
29 0.18
30 0.17
31 0.15
32 0.15
33 0.16
34 0.17
35 0.14
36 0.14
37 0.12
38 0.12
39 0.12
40 0.11
41 0.11
42 0.11
43 0.16
44 0.17
45 0.18
46 0.25
47 0.25
48 0.33
49 0.35
50 0.4
51 0.45
52 0.52
53 0.6
54 0.62
55 0.64
56 0.58