Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5B7C5

Protein Details
Accession A0A2G5B7C5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
159-182CLVMYLRVRRHYKRRGHTFAEAKQHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, mito 3, E.R. 3, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007273  SCAMP  
Gene Ontology GO:0016020  C:membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF04144  SCAMP  
Amino Acid Sequences NFPPLYPIMYHAIDVEVPAGDRRTVRTIFYLWIALEAMLVLNCVSCLIVMVSNAADVSNAGASFGSSFVYLFTITAGSFFLWYRPIYNAYMKDSSMFFYLFFIFNGFHILFDAYMAVGVPGAGSAGIIIMLQCLSSKKKAGAAFCGISFSLWVLHFVACLVMYLRVRRHYKRRGHTFAEAKQQAYMGFAQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.08
4 0.08
5 0.1
6 0.11
7 0.11
8 0.12
9 0.16
10 0.21
11 0.22
12 0.23
13 0.24
14 0.25
15 0.25
16 0.26
17 0.24
18 0.18
19 0.18
20 0.16
21 0.13
22 0.11
23 0.09
24 0.07
25 0.05
26 0.05
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.03
33 0.04
34 0.04
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.06
41 0.05
42 0.05
43 0.04
44 0.05
45 0.05
46 0.04
47 0.05
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.07
69 0.08
70 0.09
71 0.1
72 0.12
73 0.13
74 0.17
75 0.18
76 0.2
77 0.21
78 0.2
79 0.2
80 0.18
81 0.17
82 0.14
83 0.12
84 0.08
85 0.08
86 0.09
87 0.09
88 0.08
89 0.08
90 0.07
91 0.07
92 0.1
93 0.09
94 0.08
95 0.08
96 0.08
97 0.07
98 0.07
99 0.07
100 0.03
101 0.03
102 0.03
103 0.03
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.03
118 0.03
119 0.04
120 0.06
121 0.09
122 0.12
123 0.14
124 0.15
125 0.21
126 0.24
127 0.26
128 0.3
129 0.32
130 0.31
131 0.29
132 0.29
133 0.24
134 0.2
135 0.18
136 0.13
137 0.11
138 0.09
139 0.1
140 0.1
141 0.1
142 0.1
143 0.1
144 0.1
145 0.07
146 0.07
147 0.07
148 0.1
149 0.12
150 0.16
151 0.21
152 0.29
153 0.36
154 0.44
155 0.54
156 0.6
157 0.68
158 0.75
159 0.82
160 0.82
161 0.81
162 0.82
163 0.81
164 0.78
165 0.79
166 0.71
167 0.61
168 0.53
169 0.47
170 0.38
171 0.31