Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5B9X3

Protein Details
Accession A0A2G5B9X3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-126PELVGSSRSQRRKRRKRARRRAMKDRLDTLBasic
NLS Segment(s)
PositionSequence
105-120SQRRKRRKRARRRAMK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MRVLKAPIPGNIDDALAAGDIFSSDDTTALPVPLDIQLAQPEAVVGSAATSSDLHGPVSDQENVPSKRARSHTPSEDECSGQAKDLGGAEYWTQPSPELVGSSRSQRRKRRKRARRRAMKDRLDTLLDSVEAEIQNPLQERGLDQLLQVQARIATIQQNLCNAALLVADPMTTTSADASTRHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.14
3 0.09
4 0.08
5 0.05
6 0.04
7 0.04
8 0.05
9 0.05
10 0.05
11 0.05
12 0.06
13 0.06
14 0.08
15 0.09
16 0.08
17 0.08
18 0.07
19 0.08
20 0.09
21 0.1
22 0.08
23 0.09
24 0.1
25 0.11
26 0.11
27 0.1
28 0.09
29 0.08
30 0.07
31 0.06
32 0.04
33 0.03
34 0.03
35 0.04
36 0.04
37 0.05
38 0.05
39 0.08
40 0.08
41 0.08
42 0.08
43 0.09
44 0.1
45 0.13
46 0.14
47 0.12
48 0.14
49 0.22
50 0.23
51 0.25
52 0.26
53 0.24
54 0.29
55 0.32
56 0.35
57 0.33
58 0.39
59 0.44
60 0.47
61 0.49
62 0.47
63 0.45
64 0.4
65 0.34
66 0.29
67 0.22
68 0.17
69 0.15
70 0.1
71 0.09
72 0.09
73 0.09
74 0.06
75 0.06
76 0.07
77 0.07
78 0.08
79 0.08
80 0.08
81 0.07
82 0.07
83 0.08
84 0.07
85 0.07
86 0.07
87 0.1
88 0.1
89 0.18
90 0.24
91 0.32
92 0.4
93 0.49
94 0.6
95 0.69
96 0.79
97 0.84
98 0.88
99 0.91
100 0.94
101 0.96
102 0.96
103 0.94
104 0.94
105 0.93
106 0.91
107 0.85
108 0.78
109 0.69
110 0.6
111 0.5
112 0.4
113 0.3
114 0.21
115 0.16
116 0.12
117 0.11
118 0.09
119 0.09
120 0.08
121 0.08
122 0.09
123 0.1
124 0.11
125 0.09
126 0.1
127 0.1
128 0.13
129 0.15
130 0.13
131 0.12
132 0.17
133 0.18
134 0.18
135 0.17
136 0.15
137 0.13
138 0.13
139 0.13
140 0.09
141 0.11
142 0.15
143 0.19
144 0.2
145 0.22
146 0.23
147 0.23
148 0.23
149 0.18
150 0.14
151 0.11
152 0.09
153 0.08
154 0.06
155 0.06
156 0.06
157 0.06
158 0.07
159 0.07
160 0.07
161 0.08
162 0.09
163 0.11