Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BBH6

Protein Details
Accession A0A2G5BBH6   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
47-82STAPPEKKKKRLTQACQHCRKKKIRCDGIRPSCKNCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR020448  Maltose_ferment_reg_DNA-bd  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MQHLSDGAPAPTGQPTSASESALQPQHQKQAPQYDSSGELPPQATTSTAPPEKKKKRLTQACQHCRKKKIRCDGIRPSCKNCIKNKSPCTYLPSIRKRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.21
4 0.22
5 0.22
6 0.21
7 0.21
8 0.26
9 0.27
10 0.26
11 0.24
12 0.26
13 0.32
14 0.34
15 0.34
16 0.34
17 0.41
18 0.41
19 0.39
20 0.37
21 0.31
22 0.31
23 0.31
24 0.28
25 0.18
26 0.17
27 0.15
28 0.14
29 0.13
30 0.1
31 0.09
32 0.08
33 0.09
34 0.13
35 0.17
36 0.19
37 0.24
38 0.34
39 0.42
40 0.5
41 0.57
42 0.6
43 0.68
44 0.76
45 0.79
46 0.79
47 0.83
48 0.84
49 0.86
50 0.88
51 0.85
52 0.83
53 0.84
54 0.84
55 0.82
56 0.82
57 0.82
58 0.81
59 0.83
60 0.86
61 0.87
62 0.88
63 0.83
64 0.77
65 0.76
66 0.75
67 0.72
68 0.7
69 0.7
70 0.69
71 0.75
72 0.78
73 0.76
74 0.74
75 0.7
76 0.69
77 0.66
78 0.65
79 0.66