Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7S4H6

Protein Details
Accession Q7S4H6    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
58-82EAYRECKKQWIERRREQKRKAGALFHydrophilic
NLS Segment(s)
PositionSequence
72-76REQKR
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0005739  C:mitochondrion  
GO:0033108  P:mitochondrial respiratory chain complex assembly  
KEGG ncr:NCU02217  -  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MAQAGSENKEPWNEETRAKFEGKSRSEYLDPCQEAAQRSIRCLHRNQGDRTMCSDYFEAYRECKKQWIERRREQKRKAGALF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.39
4 0.39
5 0.38
6 0.36
7 0.35
8 0.42
9 0.4
10 0.41
11 0.39
12 0.39
13 0.41
14 0.4
15 0.38
16 0.37
17 0.34
18 0.29
19 0.28
20 0.26
21 0.25
22 0.26
23 0.28
24 0.2
25 0.21
26 0.26
27 0.29
28 0.3
29 0.31
30 0.34
31 0.35
32 0.42
33 0.44
34 0.47
35 0.47
36 0.45
37 0.47
38 0.46
39 0.38
40 0.33
41 0.3
42 0.22
43 0.2
44 0.21
45 0.18
46 0.16
47 0.23
48 0.24
49 0.25
50 0.3
51 0.34
52 0.42
53 0.51
54 0.58
55 0.62
56 0.7
57 0.8
58 0.85
59 0.9
60 0.88
61 0.87
62 0.87