Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5B8B7

Protein Details
Accession A0A2G5B8B7    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
85-104IQKAKKSKRAKLFYLRENPGHydrophilic
NLS Segment(s)
PositionSequence
87-95KAKKSKRAK
Subcellular Location(s) mito 21, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038657  L19_sf  
IPR001857  Ribosomal_L19  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01245  Ribosomal_L19  
Amino Acid Sequences VDGRSKLFVRRARPKDRLCAGDVVFVETFNSMSDTSATSSFTGVCIAIYRRGIDTSFILRNMVLNVGVEVRFMAYSPLMKRIEIIQKAKKSKRAKLFYLRENPGRTFQLKALKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.78
4 0.72
5 0.65
6 0.61
7 0.52
8 0.47
9 0.42
10 0.35
11 0.28
12 0.24
13 0.21
14 0.15
15 0.14
16 0.09
17 0.1
18 0.06
19 0.07
20 0.08
21 0.08
22 0.1
23 0.1
24 0.11
25 0.09
26 0.1
27 0.09
28 0.09
29 0.08
30 0.07
31 0.06
32 0.07
33 0.07
34 0.1
35 0.1
36 0.11
37 0.11
38 0.12
39 0.12
40 0.11
41 0.12
42 0.13
43 0.14
44 0.13
45 0.13
46 0.12
47 0.12
48 0.11
49 0.1
50 0.06
51 0.05
52 0.05
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.09
63 0.1
64 0.17
65 0.17
66 0.17
67 0.18
68 0.23
69 0.31
70 0.34
71 0.41
72 0.42
73 0.5
74 0.6
75 0.65
76 0.69
77 0.69
78 0.71
79 0.74
80 0.74
81 0.75
82 0.76
83 0.79
84 0.8
85 0.81
86 0.79
87 0.75
88 0.72
89 0.66
90 0.61
91 0.57
92 0.49
93 0.43
94 0.41