Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BJS2

Protein Details
Accession A0A2G5BJS2   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
92-111RSAVRVRKKMWWNNMKWKIIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 8, cyto_nucl 7.5, nucl 7, cyto 6, golg 2, mito 1, pero 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR001388  Synaptobrevin-like  
IPR016444  Synaptobrevin/VAMP  
IPR042855  V_SNARE_CC  
Gene Ontology GO:0016020  C:membrane  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF00957  Synaptobrevin  
PROSITE View protein in PROSITE  
PS50892  V_SNARE  
Amino Acid Sequences MSYNANYGNSDGGGGGGYSSNPYASYSSDNNPPGEGQGDKKLTKAQDVQLKINDAVDVMNQNIQQLNDRGDNLDVVMDKSERLRGETEMFQRSAVRVRKKMWWNNMKWKIIIGVCVLIIILVIVLSVVLSKNKDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.05
5 0.06
6 0.07
7 0.07
8 0.07
9 0.09
10 0.09
11 0.11
12 0.15
13 0.17
14 0.2
15 0.27
16 0.29
17 0.28
18 0.27
19 0.26
20 0.23
21 0.21
22 0.2
23 0.16
24 0.2
25 0.25
26 0.24
27 0.25
28 0.28
29 0.27
30 0.3
31 0.31
32 0.29
33 0.32
34 0.35
35 0.37
36 0.35
37 0.37
38 0.32
39 0.28
40 0.23
41 0.15
42 0.12
43 0.09
44 0.08
45 0.06
46 0.08
47 0.07
48 0.08
49 0.09
50 0.09
51 0.1
52 0.1
53 0.12
54 0.11
55 0.12
56 0.12
57 0.11
58 0.11
59 0.09
60 0.09
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.07
67 0.1
68 0.1
69 0.11
70 0.12
71 0.13
72 0.17
73 0.22
74 0.26
75 0.26
76 0.26
77 0.25
78 0.24
79 0.23
80 0.28
81 0.3
82 0.33
83 0.35
84 0.38
85 0.46
86 0.55
87 0.63
88 0.66
89 0.68
90 0.69
91 0.75
92 0.82
93 0.76
94 0.66
95 0.59
96 0.53
97 0.43
98 0.37
99 0.28
100 0.19
101 0.16
102 0.15
103 0.14
104 0.09
105 0.08
106 0.05
107 0.04
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.03
114 0.04
115 0.07