Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5B2I3

Protein Details
Accession A0A2G5B2I3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-44NSGVKRKCNCRSARRGRVHATHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSSSARSTSTPTSGFGSASMETVNSGVKRKCNCRSARRGRVHATPFKRAKHAAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.19
4 0.14
5 0.14
6 0.12
7 0.08
8 0.08
9 0.08
10 0.09
11 0.08
12 0.11
13 0.12
14 0.17
15 0.22
16 0.29
17 0.36
18 0.43
19 0.5
20 0.56
21 0.66
22 0.73
23 0.79
24 0.81
25 0.81
26 0.77
27 0.78
28 0.76
29 0.75
30 0.7
31 0.7
32 0.68
33 0.65
34 0.66