Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BHG7

Protein Details
Accession A0A2G5BHG7    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
174-202EDKARLKSKRDELRQAKRKRIERLEKIDGBasic
NLS Segment(s)
PositionSequence
177-196ARLKSKRDELRQAKRKRIER
Subcellular Location(s) nucl 18.5, cyto_nucl 14.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019163  THO_Thoc5  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09766  FmiP_Thoc5  
Amino Acid Sequences MSTTGRAMDIDIAVAPEAPASLDRLAAEISTLCGRVEEIAAAGVLAQNDGLVTSSGAEQLLANEITALFVRLRQLYRQLSEDKVAVVAAVDELKRGTDDLALELENKDREAAYIQREIASTETLETIYQSIDLIPEEEFLATAPESCRGDVDTPHKLMLARLRYEVMQRDMLMEDKARLKSKRDELRQAKRKRIERLEKIDGHLKGYIKSVSLLGRSLTAGDQASSQEPLGDDSNIAGDDIEERNSPNMPCQTRGDTPRAGTPRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.06
4 0.06
5 0.06
6 0.06
7 0.08
8 0.08
9 0.09
10 0.1
11 0.11
12 0.11
13 0.1
14 0.1
15 0.08
16 0.1
17 0.1
18 0.11
19 0.09
20 0.09
21 0.1
22 0.1
23 0.1
24 0.08
25 0.07
26 0.07
27 0.07
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.05
38 0.04
39 0.04
40 0.05
41 0.06
42 0.06
43 0.06
44 0.07
45 0.06
46 0.06
47 0.09
48 0.08
49 0.08
50 0.07
51 0.07
52 0.08
53 0.08
54 0.08
55 0.06
56 0.07
57 0.09
58 0.12
59 0.14
60 0.15
61 0.23
62 0.26
63 0.28
64 0.31
65 0.32
66 0.31
67 0.31
68 0.3
69 0.22
70 0.18
71 0.16
72 0.11
73 0.08
74 0.06
75 0.05
76 0.06
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.07
86 0.07
87 0.08
88 0.08
89 0.09
90 0.09
91 0.11
92 0.09
93 0.09
94 0.08
95 0.07
96 0.08
97 0.09
98 0.12
99 0.13
100 0.16
101 0.16
102 0.16
103 0.17
104 0.17
105 0.15
106 0.13
107 0.09
108 0.07
109 0.07
110 0.07
111 0.06
112 0.06
113 0.05
114 0.05
115 0.05
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.04
122 0.05
123 0.05
124 0.05
125 0.05
126 0.04
127 0.05
128 0.04
129 0.05
130 0.05
131 0.08
132 0.09
133 0.09
134 0.09
135 0.09
136 0.11
137 0.14
138 0.19
139 0.2
140 0.2
141 0.21
142 0.21
143 0.2
144 0.21
145 0.23
146 0.23
147 0.2
148 0.2
149 0.21
150 0.21
151 0.24
152 0.26
153 0.22
154 0.19
155 0.17
156 0.18
157 0.18
158 0.18
159 0.16
160 0.13
161 0.12
162 0.16
163 0.19
164 0.23
165 0.25
166 0.28
167 0.36
168 0.45
169 0.52
170 0.54
171 0.62
172 0.67
173 0.76
174 0.81
175 0.81
176 0.81
177 0.8
178 0.81
179 0.8
180 0.8
181 0.8
182 0.8
183 0.81
184 0.8
185 0.74
186 0.7
187 0.68
188 0.57
189 0.49
190 0.43
191 0.35
192 0.27
193 0.27
194 0.24
195 0.18
196 0.18
197 0.18
198 0.17
199 0.17
200 0.17
201 0.14
202 0.14
203 0.14
204 0.14
205 0.12
206 0.12
207 0.11
208 0.1
209 0.11
210 0.11
211 0.13
212 0.13
213 0.12
214 0.11
215 0.11
216 0.13
217 0.14
218 0.13
219 0.12
220 0.11
221 0.12
222 0.11
223 0.11
224 0.08
225 0.06
226 0.09
227 0.1
228 0.12
229 0.11
230 0.12
231 0.14
232 0.17
233 0.18
234 0.22
235 0.3
236 0.31
237 0.34
238 0.39
239 0.44
240 0.48
241 0.54
242 0.53
243 0.49
244 0.48
245 0.53