Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5B7K9

Protein Details
Accession A0A2G5B7K9   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
42-67HWFCRECSHQRSRKRKSRAHAKNIFYHydrophilic
NLS Segment(s)
PositionSequence
54-59RKRKSR
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00628  PHD  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
PS50016  ZF_PHD_2  
Amino Acid Sequences HDVCDACGQSGEFICCEHCPRVFHFLCVEPPMTPDDVRQIDHWFCRECSHQRSRKRKSRAHAKNIFYPLISNIEYSNPRTFSVPEEIRRLFDGVEADVDGSYVNVREDRQQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.19
4 0.2
5 0.21
6 0.22
7 0.25
8 0.35
9 0.33
10 0.33
11 0.33
12 0.32
13 0.32
14 0.32
15 0.29
16 0.19
17 0.2
18 0.2
19 0.19
20 0.16
21 0.14
22 0.18
23 0.19
24 0.2
25 0.2
26 0.22
27 0.22
28 0.24
29 0.26
30 0.21
31 0.2
32 0.22
33 0.25
34 0.27
35 0.33
36 0.41
37 0.46
38 0.54
39 0.65
40 0.72
41 0.77
42 0.8
43 0.79
44 0.78
45 0.81
46 0.82
47 0.81
48 0.8
49 0.74
50 0.72
51 0.7
52 0.61
53 0.5
54 0.4
55 0.31
56 0.25
57 0.22
58 0.15
59 0.11
60 0.15
61 0.17
62 0.2
63 0.22
64 0.2
65 0.2
66 0.21
67 0.21
68 0.21
69 0.28
70 0.3
71 0.31
72 0.36
73 0.36
74 0.36
75 0.37
76 0.34
77 0.25
78 0.22
79 0.19
80 0.14
81 0.14
82 0.12
83 0.11
84 0.1
85 0.1
86 0.08
87 0.06
88 0.06
89 0.06
90 0.07
91 0.09
92 0.1