Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5INR8

Protein Details
Accession V5INR8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-45KVKSQTPKVEKQEKKKTPKGRAKKRLTYTRRFVBasic
NLS Segment(s)
PositionSequence
12-37GKVKSQTPKVEKQEKKKTPKGRAKKR
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 9, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncr:NCU09089  -  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKKKTPKGRAKKRLTYTRRFVNVTMTGGKRKMNPNPGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.49
5 0.53
6 0.62
7 0.65
8 0.71
9 0.71
10 0.74
11 0.78
12 0.78
13 0.81
14 0.81
15 0.81
16 0.81
17 0.85
18 0.85
19 0.85
20 0.87
21 0.87
22 0.87
23 0.87
24 0.87
25 0.85
26 0.83
27 0.79
28 0.77
29 0.73
30 0.66
31 0.58
32 0.54
33 0.49
34 0.43
35 0.42
36 0.36
37 0.35
38 0.35
39 0.37
40 0.37
41 0.42
42 0.47