Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5BF07

Protein Details
Accession A0A2G5BF07    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
468-491VTSSKPIYDQKTKKRTNPYQSGAGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 21, cyto_nucl 12.5, nucl 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046450  PA_dom_sf  
IPR003137  PA_domain  
IPR000209  Peptidase_S8/S53_dom  
IPR036852  Peptidase_S8/S53_dom_sf  
IPR023827  Peptidase_S8_Asp-AS  
IPR022398  Peptidase_S8_His-AS  
IPR015500  Peptidase_S8_subtilisin-rel  
Gene Ontology GO:0004252  F:serine-type endopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF02225  PA  
PF00082  Peptidase_S8  
PROSITE View protein in PROSITE  
PS51892  SUBTILASE  
PS00136  SUBTILASE_ASP  
PS00137  SUBTILASE_HIS  
Amino Acid Sequences MAITAGDSVELSDLAGIDGVKKVYPNRIRKLTTRAGNGTGNHTFAHLHRETGLDKVVNELGLNGKGVMIGIVDSGVDYMHPNLGACWKTKGCRWQYGEDFIGDKYGVSNNFVIKPNPTPMDCDGHGTHVSGIMASTGFQVQGVAPNATYGMYRIFSCAGSNGEIITEDAIIIKAMEAAYKDGHDIISLSIGGGSWADDPTSVVASKLVANGVVVIAAAGDYGYDGLFTAQSPSLGNGVISVGSVDNWIYTSAPLLVHTKIGPYTISKIDVTTKKSIFVFKEPVPVVAPKDITGSTNCCNTIKAKLKGKLAFIPHGNCTFNEKAIAAQNAGAVGLLYYDEQHRIMPPKVNDSITIPIAMLGNDSGKLILAALSDGPVTAMVSKNYKNIINKTGGKMSIFSSYGPTPELGLVPLLSAPGGDIWSTYPRKKHNYASLSGTSMAASYVSGAAALIKQAHPQLSVDRIRELLVTSSKPIYDQKTKKRTNPYQSGAGIVNIYNAVKSRFHVDQTILSINDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.06
4 0.07
5 0.09
6 0.1
7 0.1
8 0.13
9 0.17
10 0.26
11 0.36
12 0.45
13 0.52
14 0.61
15 0.65
16 0.69
17 0.75
18 0.74
19 0.72
20 0.71
21 0.65
22 0.61
23 0.61
24 0.56
25 0.54
26 0.47
27 0.4
28 0.32
29 0.28
30 0.25
31 0.21
32 0.28
33 0.22
34 0.21
35 0.2
36 0.23
37 0.23
38 0.24
39 0.28
40 0.2
41 0.19
42 0.22
43 0.22
44 0.19
45 0.18
46 0.16
47 0.15
48 0.14
49 0.15
50 0.11
51 0.1
52 0.1
53 0.1
54 0.08
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.06
66 0.07
67 0.08
68 0.08
69 0.09
70 0.15
71 0.16
72 0.17
73 0.22
74 0.25
75 0.28
76 0.33
77 0.42
78 0.43
79 0.51
80 0.54
81 0.57
82 0.59
83 0.62
84 0.58
85 0.5
86 0.44
87 0.34
88 0.31
89 0.22
90 0.16
91 0.12
92 0.14
93 0.13
94 0.14
95 0.16
96 0.17
97 0.22
98 0.25
99 0.24
100 0.24
101 0.26
102 0.3
103 0.31
104 0.29
105 0.28
106 0.29
107 0.34
108 0.31
109 0.33
110 0.28
111 0.28
112 0.28
113 0.25
114 0.22
115 0.17
116 0.17
117 0.11
118 0.11
119 0.07
120 0.07
121 0.06
122 0.07
123 0.06
124 0.06
125 0.05
126 0.06
127 0.06
128 0.1
129 0.12
130 0.12
131 0.11
132 0.11
133 0.11
134 0.11
135 0.11
136 0.07
137 0.07
138 0.08
139 0.08
140 0.09
141 0.1
142 0.1
143 0.11
144 0.12
145 0.11
146 0.12
147 0.12
148 0.1
149 0.09
150 0.09
151 0.09
152 0.08
153 0.06
154 0.05
155 0.05
156 0.05
157 0.05
158 0.04
159 0.04
160 0.05
161 0.04
162 0.05
163 0.06
164 0.07
165 0.08
166 0.08
167 0.08
168 0.08
169 0.08
170 0.07
171 0.07
172 0.06
173 0.06
174 0.06
175 0.05
176 0.05
177 0.05
178 0.05
179 0.04
180 0.04
181 0.04
182 0.05
183 0.05
184 0.05
185 0.05
186 0.06
187 0.07
188 0.06
189 0.06
190 0.06
191 0.07
192 0.07
193 0.08
194 0.07
195 0.06
196 0.06
197 0.06
198 0.05
199 0.04
200 0.03
201 0.03
202 0.02
203 0.02
204 0.02
205 0.02
206 0.02
207 0.02
208 0.02
209 0.02
210 0.02
211 0.02
212 0.03
213 0.03
214 0.03
215 0.05
216 0.05
217 0.06
218 0.06
219 0.07
220 0.07
221 0.07
222 0.07
223 0.05
224 0.05
225 0.05
226 0.04
227 0.04
228 0.03
229 0.03
230 0.04
231 0.04
232 0.03
233 0.04
234 0.04
235 0.04
236 0.04
237 0.05
238 0.05
239 0.05
240 0.07
241 0.08
242 0.08
243 0.09
244 0.09
245 0.09
246 0.08
247 0.09
248 0.08
249 0.07
250 0.1
251 0.11
252 0.12
253 0.12
254 0.12
255 0.18
256 0.22
257 0.25
258 0.27
259 0.26
260 0.27
261 0.28
262 0.31
263 0.27
264 0.27
265 0.28
266 0.24
267 0.31
268 0.28
269 0.28
270 0.26
271 0.25
272 0.22
273 0.2
274 0.19
275 0.12
276 0.14
277 0.13
278 0.12
279 0.13
280 0.15
281 0.14
282 0.16
283 0.17
284 0.15
285 0.16
286 0.17
287 0.24
288 0.29
289 0.35
290 0.41
291 0.45
292 0.51
293 0.54
294 0.55
295 0.51
296 0.46
297 0.43
298 0.38
299 0.35
300 0.31
301 0.31
302 0.29
303 0.24
304 0.28
305 0.24
306 0.22
307 0.2
308 0.18
309 0.16
310 0.19
311 0.19
312 0.13
313 0.13
314 0.12
315 0.11
316 0.11
317 0.09
318 0.05
319 0.04
320 0.03
321 0.03
322 0.03
323 0.04
324 0.05
325 0.06
326 0.07
327 0.07
328 0.1
329 0.14
330 0.17
331 0.23
332 0.24
333 0.29
334 0.32
335 0.32
336 0.3
337 0.29
338 0.29
339 0.23
340 0.22
341 0.16
342 0.14
343 0.13
344 0.12
345 0.09
346 0.06
347 0.06
348 0.06
349 0.06
350 0.06
351 0.05
352 0.05
353 0.05
354 0.05
355 0.04
356 0.05
357 0.05
358 0.05
359 0.05
360 0.05
361 0.05
362 0.04
363 0.04
364 0.06
365 0.07
366 0.09
367 0.13
368 0.14
369 0.17
370 0.2
371 0.25
372 0.29
373 0.32
374 0.36
375 0.4
376 0.43
377 0.44
378 0.46
379 0.43
380 0.38
381 0.34
382 0.31
383 0.27
384 0.23
385 0.2
386 0.19
387 0.18
388 0.18
389 0.18
390 0.17
391 0.13
392 0.13
393 0.13
394 0.1
395 0.09
396 0.08
397 0.08
398 0.07
399 0.07
400 0.05
401 0.05
402 0.04
403 0.05
404 0.05
405 0.05
406 0.05
407 0.07
408 0.15
409 0.2
410 0.24
411 0.3
412 0.37
413 0.46
414 0.52
415 0.59
416 0.61
417 0.63
418 0.63
419 0.64
420 0.59
421 0.54
422 0.48
423 0.39
424 0.29
425 0.23
426 0.18
427 0.11
428 0.08
429 0.06
430 0.06
431 0.05
432 0.05
433 0.05
434 0.05
435 0.06
436 0.07
437 0.09
438 0.09
439 0.12
440 0.15
441 0.17
442 0.17
443 0.18
444 0.21
445 0.27
446 0.32
447 0.31
448 0.3
449 0.3
450 0.29
451 0.29
452 0.26
453 0.23
454 0.22
455 0.22
456 0.23
457 0.25
458 0.24
459 0.26
460 0.3
461 0.33
462 0.39
463 0.47
464 0.55
465 0.64
466 0.73
467 0.79
468 0.84
469 0.87
470 0.87
471 0.87
472 0.82
473 0.8
474 0.72
475 0.68
476 0.57
477 0.48
478 0.39
479 0.28
480 0.23
481 0.16
482 0.15
483 0.13
484 0.13
485 0.15
486 0.15
487 0.16
488 0.21
489 0.24
490 0.26
491 0.3
492 0.31
493 0.33
494 0.37
495 0.41