Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5BCF5

Protein Details
Accession A0A2G5BCF5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
22-45FICPIFRSPFRRNKKRQYVLTMDCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 7, pero 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013933  CRC_Rsc7/Swp82  
Pfam View protein in Pfam  
PF08624  CRC_subunit  
Amino Acid Sequences EKDMAGEAKIDNNGYMQGGREFICPIFRSPFRRNKKRQYVLTMDCCRYMGARDSYMLFKQHPRMRRVETTQEERDLLADRQMIPKVTRFRPIALITARTAFREFGARIIKNGRYIVDDYW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.11
5 0.12
6 0.13
7 0.13
8 0.14
9 0.13
10 0.17
11 0.17
12 0.19
13 0.24
14 0.27
15 0.34
16 0.41
17 0.51
18 0.57
19 0.67
20 0.74
21 0.78
22 0.85
23 0.86
24 0.85
25 0.83
26 0.81
27 0.77
28 0.77
29 0.72
30 0.62
31 0.53
32 0.46
33 0.38
34 0.3
35 0.24
36 0.19
37 0.16
38 0.15
39 0.16
40 0.17
41 0.18
42 0.19
43 0.19
44 0.15
45 0.16
46 0.23
47 0.26
48 0.32
49 0.33
50 0.37
51 0.41
52 0.45
53 0.47
54 0.49
55 0.5
56 0.51
57 0.5
58 0.47
59 0.42
60 0.36
61 0.32
62 0.25
63 0.2
64 0.15
65 0.14
66 0.13
67 0.16
68 0.17
69 0.18
70 0.16
71 0.22
72 0.28
73 0.29
74 0.35
75 0.34
76 0.35
77 0.39
78 0.4
79 0.4
80 0.35
81 0.35
82 0.29
83 0.32
84 0.3
85 0.26
86 0.25
87 0.2
88 0.18
89 0.21
90 0.2
91 0.22
92 0.3
93 0.29
94 0.31
95 0.37
96 0.39
97 0.38
98 0.39
99 0.34
100 0.3