Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BIA0

Protein Details
Accession A0A2G5BIA0    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-25HNMLKCHVKNCKNPDKQFPLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 8, cyto 8, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR039127  Trm112  
IPR005651  Trm112-like  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF03966  Trm112p  
CDD cd21089  Trm112-like  
Amino Acid Sequences MRLITHNMLKCHVKNCKNPDKQFPLQFKDVKLEQIEAERNDEFLVRMLPRLDWSALLKTTKELGIVIPEKVPANPADDDEFLQALHTAILEMHVKEGSMICNGCGHEYKITKGIPNMLLAEHEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.67
3 0.73
4 0.76
5 0.79
6 0.81
7 0.8
8 0.8
9 0.79
10 0.77
11 0.72
12 0.69
13 0.66
14 0.57
15 0.54
16 0.47
17 0.42
18 0.35
19 0.3
20 0.24
21 0.26
22 0.29
23 0.23
24 0.26
25 0.22
26 0.2
27 0.19
28 0.18
29 0.14
30 0.1
31 0.12
32 0.08
33 0.1
34 0.1
35 0.1
36 0.11
37 0.12
38 0.12
39 0.11
40 0.12
41 0.13
42 0.14
43 0.15
44 0.14
45 0.13
46 0.13
47 0.12
48 0.11
49 0.09
50 0.07
51 0.11
52 0.12
53 0.12
54 0.11
55 0.12
56 0.12
57 0.11
58 0.13
59 0.08
60 0.11
61 0.11
62 0.12
63 0.13
64 0.14
65 0.14
66 0.14
67 0.13
68 0.1
69 0.1
70 0.09
71 0.06
72 0.06
73 0.05
74 0.04
75 0.04
76 0.06
77 0.07
78 0.07
79 0.08
80 0.08
81 0.08
82 0.09
83 0.1
84 0.09
85 0.11
86 0.11
87 0.1
88 0.13
89 0.14
90 0.16
91 0.18
92 0.19
93 0.22
94 0.24
95 0.27
96 0.3
97 0.31
98 0.32
99 0.32
100 0.36
101 0.31
102 0.31
103 0.3
104 0.25