Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BDP0

Protein Details
Accession A0A2G5BDP0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
59-90EVSKETEKPKKCDEPRKENKRSGRRQSTDTMRBasic
594-616AQSVPVGRRKPDRHARRPISTLFHydrophilic
NLS Segment(s)
PositionSequence
75-79KENKR
Subcellular Location(s) mito 10, nucl 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000306  Znf_FYVE  
IPR017455  Znf_FYVE-rel  
IPR011011  Znf_FYVE_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01363  FYVE  
PROSITE View protein in PROSITE  
PS50178  ZF_FYVE  
Amino Acid Sequences MTSKQRQNSTGKAKATGDTLPARSSLGLYRCSGDGVEQSSEAGEASEFRGVDKPRNETEVSKETEKPKKCDEPRKENKRSGRRQSTDTMRTMRSLDRQYGRRRRLNSEQLTQVATTEGNTAVARRGDTRGLFAPLCQAATETAVAEGSAAAGPTQLTRQLVAMAGRLAGQSGGVRARASMPLINGVRRAPQRTRSQAATRPARDELSGALTMKAVEIRGGRIVLDDPSSSEDSDACYASAAGVTQRPSIGSSVCSAIGDDALRRRWYTRRCLGIRQPFSSVHRLAKAEHDSSEPFSLLNDMRRVVHEARVRVLMDTGPGAITSLIEDADSGVAADVLLCTDAIVVCAPDSKSLQPLRAMEFGDGLAVRFGEATQTALIYADECNMELAFPQGGAREWVERVVQARTRYATTMQDLRLDEEDYVDRPPLPLLLRGRCSISGTLPTAGSVSAAGEPRRLRNAAQGGVYWVPDAETSVCMVCRTTAFSMMVRRHHCRACGLVICYRCSAVDAARRRLCLRCSTLYRPAVTIGSASVSGSLAPRSKPSVMSLRSRAAEYLPSVRGSSVHTAEGHPATAAPDMSFATDTPTVTAPDPDAQSVPVGRRKPDRHARRPISTLFGVQDTQEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.5
3 0.42
4 0.38
5 0.36
6 0.35
7 0.31
8 0.29
9 0.28
10 0.25
11 0.25
12 0.25
13 0.23
14 0.24
15 0.25
16 0.26
17 0.25
18 0.26
19 0.24
20 0.2
21 0.19
22 0.2
23 0.2
24 0.18
25 0.17
26 0.17
27 0.17
28 0.14
29 0.11
30 0.07
31 0.07
32 0.08
33 0.11
34 0.11
35 0.12
36 0.19
37 0.21
38 0.29
39 0.33
40 0.38
41 0.38
42 0.44
43 0.45
44 0.41
45 0.47
46 0.47
47 0.47
48 0.45
49 0.47
50 0.51
51 0.58
52 0.62
53 0.6
54 0.61
55 0.66
56 0.72
57 0.77
58 0.79
59 0.81
60 0.85
61 0.9
62 0.91
63 0.89
64 0.9
65 0.9
66 0.9
67 0.9
68 0.9
69 0.84
70 0.8
71 0.8
72 0.8
73 0.76
74 0.72
75 0.66
76 0.57
77 0.53
78 0.5
79 0.46
80 0.44
81 0.42
82 0.43
83 0.46
84 0.52
85 0.61
86 0.69
87 0.74
88 0.73
89 0.73
90 0.73
91 0.76
92 0.78
93 0.75
94 0.71
95 0.67
96 0.62
97 0.58
98 0.5
99 0.4
100 0.3
101 0.22
102 0.16
103 0.12
104 0.1
105 0.1
106 0.1
107 0.1
108 0.13
109 0.14
110 0.14
111 0.15
112 0.18
113 0.2
114 0.21
115 0.24
116 0.23
117 0.26
118 0.25
119 0.23
120 0.25
121 0.21
122 0.21
123 0.17
124 0.15
125 0.11
126 0.13
127 0.13
128 0.08
129 0.08
130 0.07
131 0.07
132 0.06
133 0.06
134 0.05
135 0.05
136 0.04
137 0.04
138 0.04
139 0.05
140 0.05
141 0.07
142 0.08
143 0.09
144 0.09
145 0.1
146 0.1
147 0.12
148 0.12
149 0.12
150 0.1
151 0.1
152 0.1
153 0.09
154 0.08
155 0.06
156 0.06
157 0.05
158 0.07
159 0.08
160 0.09
161 0.09
162 0.09
163 0.11
164 0.12
165 0.13
166 0.13
167 0.12
168 0.18
169 0.2
170 0.2
171 0.2
172 0.2
173 0.25
174 0.27
175 0.32
176 0.3
177 0.37
178 0.45
179 0.51
180 0.54
181 0.54
182 0.57
183 0.58
184 0.62
185 0.63
186 0.56
187 0.53
188 0.5
189 0.45
190 0.39
191 0.32
192 0.24
193 0.19
194 0.18
195 0.15
196 0.13
197 0.12
198 0.12
199 0.11
200 0.11
201 0.07
202 0.08
203 0.08
204 0.09
205 0.1
206 0.1
207 0.1
208 0.1
209 0.11
210 0.09
211 0.1
212 0.09
213 0.08
214 0.12
215 0.13
216 0.12
217 0.11
218 0.11
219 0.11
220 0.12
221 0.12
222 0.08
223 0.07
224 0.07
225 0.07
226 0.07
227 0.05
228 0.05
229 0.07
230 0.08
231 0.09
232 0.09
233 0.09
234 0.1
235 0.11
236 0.1
237 0.09
238 0.09
239 0.1
240 0.1
241 0.09
242 0.08
243 0.08
244 0.08
245 0.07
246 0.08
247 0.09
248 0.12
249 0.13
250 0.14
251 0.17
252 0.23
253 0.29
254 0.37
255 0.41
256 0.47
257 0.49
258 0.56
259 0.62
260 0.65
261 0.64
262 0.57
263 0.53
264 0.46
265 0.47
266 0.45
267 0.38
268 0.3
269 0.29
270 0.27
271 0.25
272 0.28
273 0.29
274 0.24
275 0.23
276 0.22
277 0.2
278 0.21
279 0.21
280 0.15
281 0.11
282 0.1
283 0.11
284 0.1
285 0.12
286 0.12
287 0.11
288 0.12
289 0.13
290 0.17
291 0.16
292 0.21
293 0.22
294 0.22
295 0.22
296 0.24
297 0.23
298 0.19
299 0.18
300 0.12
301 0.09
302 0.08
303 0.07
304 0.05
305 0.04
306 0.05
307 0.04
308 0.04
309 0.04
310 0.04
311 0.03
312 0.03
313 0.03
314 0.03
315 0.03
316 0.03
317 0.03
318 0.03
319 0.02
320 0.02
321 0.02
322 0.02
323 0.02
324 0.02
325 0.02
326 0.02
327 0.02
328 0.03
329 0.03
330 0.03
331 0.03
332 0.03
333 0.05
334 0.06
335 0.07
336 0.08
337 0.09
338 0.15
339 0.16
340 0.18
341 0.19
342 0.21
343 0.23
344 0.24
345 0.24
346 0.18
347 0.17
348 0.15
349 0.13
350 0.11
351 0.08
352 0.06
353 0.05
354 0.04
355 0.04
356 0.04
357 0.04
358 0.04
359 0.05
360 0.05
361 0.05
362 0.05
363 0.05
364 0.05
365 0.05
366 0.05
367 0.05
368 0.05
369 0.06
370 0.06
371 0.05
372 0.05
373 0.05
374 0.06
375 0.05
376 0.05
377 0.05
378 0.05
379 0.05
380 0.07
381 0.08
382 0.08
383 0.09
384 0.1
385 0.1
386 0.11
387 0.12
388 0.15
389 0.18
390 0.18
391 0.21
392 0.21
393 0.22
394 0.22
395 0.23
396 0.22
397 0.21
398 0.25
399 0.23
400 0.26
401 0.25
402 0.26
403 0.25
404 0.23
405 0.19
406 0.16
407 0.16
408 0.12
409 0.13
410 0.12
411 0.1
412 0.1
413 0.1
414 0.11
415 0.11
416 0.16
417 0.2
418 0.25
419 0.28
420 0.29
421 0.31
422 0.29
423 0.3
424 0.26
425 0.22
426 0.21
427 0.2
428 0.2
429 0.18
430 0.17
431 0.15
432 0.13
433 0.12
434 0.07
435 0.06
436 0.08
437 0.1
438 0.11
439 0.15
440 0.17
441 0.2
442 0.24
443 0.24
444 0.23
445 0.28
446 0.34
447 0.32
448 0.31
449 0.29
450 0.28
451 0.27
452 0.27
453 0.18
454 0.13
455 0.1
456 0.09
457 0.1
458 0.07
459 0.07
460 0.08
461 0.09
462 0.09
463 0.09
464 0.09
465 0.09
466 0.09
467 0.12
468 0.13
469 0.15
470 0.17
471 0.19
472 0.26
473 0.3
474 0.37
475 0.39
476 0.43
477 0.46
478 0.48
479 0.47
480 0.43
481 0.43
482 0.41
483 0.41
484 0.39
485 0.38
486 0.37
487 0.37
488 0.34
489 0.31
490 0.25
491 0.21
492 0.19
493 0.19
494 0.25
495 0.3
496 0.39
497 0.42
498 0.44
499 0.46
500 0.49
501 0.48
502 0.48
503 0.47
504 0.46
505 0.5
506 0.54
507 0.61
508 0.6
509 0.58
510 0.5
511 0.46
512 0.38
513 0.31
514 0.25
515 0.16
516 0.13
517 0.11
518 0.1
519 0.09
520 0.08
521 0.08
522 0.09
523 0.12
524 0.13
525 0.14
526 0.17
527 0.21
528 0.23
529 0.24
530 0.29
531 0.35
532 0.37
533 0.44
534 0.46
535 0.48
536 0.48
537 0.47
538 0.43
539 0.35
540 0.34
541 0.29
542 0.3
543 0.26
544 0.26
545 0.25
546 0.24
547 0.24
548 0.24
549 0.27
550 0.23
551 0.23
552 0.23
553 0.24
554 0.29
555 0.29
556 0.25
557 0.19
558 0.17
559 0.15
560 0.16
561 0.15
562 0.1
563 0.11
564 0.11
565 0.12
566 0.13
567 0.11
568 0.14
569 0.16
570 0.16
571 0.16
572 0.17
573 0.18
574 0.18
575 0.2
576 0.17
577 0.21
578 0.22
579 0.22
580 0.21
581 0.2
582 0.22
583 0.24
584 0.28
585 0.3
586 0.32
587 0.36
588 0.46
589 0.51
590 0.59
591 0.66
592 0.71
593 0.74
594 0.82
595 0.85
596 0.83
597 0.84
598 0.77
599 0.74
600 0.65
601 0.58
602 0.49
603 0.43
604 0.35