Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5B743

Protein Details
Accession A0A2G5B743    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-28IERRHATLCKQQERKCNRPNHydrophilic
NLS Segment(s)
PositionSequence
118-126LRNGGKKRR
Subcellular Location(s) nucl 11.5, mito_nucl 8.5, cyto 6, mito 4.5, cyto_pero 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036028  SH3-like_dom_sf  
IPR001452  SH3_domain  
Pfam View protein in Pfam  
PF07653  SH3_2  
Amino Acid Sequences MLALSETNIERRHATLCKQQERKCNRPNLNVDTRFVIAHTDFESQYKGILSIRRGDIIRVQAGGNTHPKWWLGTVVKSYYGSKGYGYFFPVLTESYDFMDTRIAPRIPMVLLDPNGKLRNGGKKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.44
4 0.53
5 0.61
6 0.65
7 0.7
8 0.76
9 0.8
10 0.8
11 0.8
12 0.77
13 0.77
14 0.79
15 0.78
16 0.79
17 0.71
18 0.64
19 0.56
20 0.49
21 0.4
22 0.32
23 0.25
24 0.15
25 0.14
26 0.14
27 0.14
28 0.13
29 0.14
30 0.15
31 0.12
32 0.13
33 0.11
34 0.1
35 0.1
36 0.13
37 0.13
38 0.17
39 0.17
40 0.2
41 0.19
42 0.2
43 0.2
44 0.2
45 0.19
46 0.16
47 0.15
48 0.13
49 0.13
50 0.15
51 0.16
52 0.15
53 0.14
54 0.14
55 0.14
56 0.14
57 0.14
58 0.17
59 0.14
60 0.16
61 0.19
62 0.19
63 0.2
64 0.21
65 0.21
66 0.18
67 0.18
68 0.16
69 0.14
70 0.15
71 0.16
72 0.16
73 0.18
74 0.17
75 0.15
76 0.15
77 0.15
78 0.13
79 0.13
80 0.13
81 0.11
82 0.12
83 0.14
84 0.13
85 0.12
86 0.14
87 0.13
88 0.14
89 0.2
90 0.18
91 0.16
92 0.17
93 0.19
94 0.16
95 0.17
96 0.18
97 0.17
98 0.19
99 0.22
100 0.23
101 0.27
102 0.29
103 0.28
104 0.29
105 0.29
106 0.38