Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5BBW0

Protein Details
Accession A0A2G5BBW0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-58LSRLRTKNGRRIIQNRKLKGRKFLSHydrophilic
NLS Segment(s)
PositionSequence
26-56KRKRRHGFLSRLRTKNGRRIIQNRKLKGRKF
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MISIGEIQQQVRWRTSGNEYQPSNLKRKRRHGFLSRLRTKNGRRIIQNRKLKGRKFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.36
4 0.36
5 0.41
6 0.4
7 0.42
8 0.48
9 0.47
10 0.5
11 0.47
12 0.5
13 0.5
14 0.6
15 0.65
16 0.65
17 0.7
18 0.7
19 0.75
20 0.76
21 0.79
22 0.78
23 0.74
24 0.7
25 0.7
26 0.66
27 0.65
28 0.64
29 0.59
30 0.59
31 0.66
32 0.74
33 0.76
34 0.8
35 0.79
36 0.81
37 0.84
38 0.8
39 0.81