Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5B5N7

Protein Details
Accession A0A2G5B5N7   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
81-125REKLIERRRKREEKLQRELHESKMSERKRMRMKRKELRARAHAKHBasic
NLS Segment(s)
PositionSequence
81-125REKLIERRRKREEKLQRELHESKMSERKRMRMKRKELRARAHAKH
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MAGATEAQDGFKAATHQGTPLTRVSGRPWKQPKSAANRSMMSKTLRRTYQQRMEKHRDQLALKQTQQELHDEKEAEKTALREKLIERRRKREEKLQRELHESKMSERKRMRMKRKELRARAHAKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.15
4 0.19
5 0.2
6 0.21
7 0.21
8 0.24
9 0.22
10 0.23
11 0.28
12 0.34
13 0.36
14 0.44
15 0.51
16 0.54
17 0.57
18 0.64
19 0.65
20 0.65
21 0.71
22 0.67
23 0.63
24 0.59
25 0.58
26 0.52
27 0.47
28 0.41
29 0.36
30 0.34
31 0.36
32 0.36
33 0.37
34 0.41
35 0.46
36 0.52
37 0.56
38 0.59
39 0.62
40 0.68
41 0.69
42 0.68
43 0.63
44 0.58
45 0.51
46 0.49
47 0.48
48 0.44
49 0.39
50 0.37
51 0.33
52 0.31
53 0.31
54 0.29
55 0.24
56 0.21
57 0.22
58 0.2
59 0.2
60 0.21
61 0.21
62 0.17
63 0.16
64 0.16
65 0.19
66 0.22
67 0.21
68 0.2
69 0.22
70 0.31
71 0.39
72 0.48
73 0.5
74 0.55
75 0.65
76 0.72
77 0.75
78 0.76
79 0.79
80 0.79
81 0.82
82 0.82
83 0.75
84 0.75
85 0.72
86 0.67
87 0.62
88 0.53
89 0.49
90 0.5
91 0.49
92 0.5
93 0.52
94 0.55
95 0.59
96 0.69
97 0.73
98 0.74
99 0.83
100 0.84
101 0.9
102 0.93
103 0.91
104 0.9
105 0.9