Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7RYZ0

Protein Details
Accession Q7RYZ0   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-29TTTPPPSRPQPPKKMSITQTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11.5, mito 5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037738  Ecm13-like  
KEGG ncr:NCU06425  -  
Amino Acid Sequences MSSTTTHTATTTPPPSRPQPPKKMSITQTYYLAHKARAKLSSEAARPDHNLRLLVGHANLLDSLMVELADAEREQESWFNQSVRGASNSRSEERHIQWADTVVREPEHDWQAEDAEYSDSDSDSDSDLSEDDEEDCDEDEDVEMADAVPLRRIPSHSSGSLHRYSMQAPLHQFYNYDQDMEEDEEDDDEDYTHLALQRSPSHSASPPELDLDSDSSEDEHMPPSPPTTILSTFSSTSPEKQAGEQQGDDEEDQQEQDKDAFYTHNQGYYLPSRGPTLVSPIGMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.48
3 0.57
4 0.65
5 0.67
6 0.7
7 0.73
8 0.77
9 0.79
10 0.81
11 0.76
12 0.75
13 0.71
14 0.63
15 0.61
16 0.54
17 0.49
18 0.46
19 0.42
20 0.38
21 0.37
22 0.38
23 0.39
24 0.42
25 0.43
26 0.41
27 0.45
28 0.47
29 0.45
30 0.46
31 0.43
32 0.41
33 0.41
34 0.42
35 0.4
36 0.35
37 0.32
38 0.26
39 0.26
40 0.24
41 0.23
42 0.19
43 0.15
44 0.13
45 0.12
46 0.12
47 0.1
48 0.08
49 0.06
50 0.06
51 0.04
52 0.04
53 0.03
54 0.04
55 0.04
56 0.05
57 0.04
58 0.05
59 0.05
60 0.06
61 0.07
62 0.09
63 0.09
64 0.12
65 0.15
66 0.14
67 0.15
68 0.16
69 0.17
70 0.17
71 0.2
72 0.18
73 0.18
74 0.24
75 0.27
76 0.28
77 0.29
78 0.3
79 0.33
80 0.34
81 0.41
82 0.35
83 0.31
84 0.29
85 0.32
86 0.3
87 0.24
88 0.23
89 0.14
90 0.14
91 0.14
92 0.15
93 0.15
94 0.16
95 0.16
96 0.15
97 0.15
98 0.15
99 0.15
100 0.14
101 0.1
102 0.08
103 0.07
104 0.07
105 0.07
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.04
127 0.04
128 0.04
129 0.03
130 0.03
131 0.03
132 0.03
133 0.04
134 0.04
135 0.04
136 0.05
137 0.06
138 0.07
139 0.09
140 0.12
141 0.16
142 0.2
143 0.21
144 0.22
145 0.24
146 0.28
147 0.28
148 0.26
149 0.22
150 0.2
151 0.19
152 0.23
153 0.21
154 0.2
155 0.2
156 0.21
157 0.21
158 0.2
159 0.2
160 0.15
161 0.2
162 0.17
163 0.16
164 0.14
165 0.14
166 0.16
167 0.17
168 0.15
169 0.09
170 0.09
171 0.09
172 0.09
173 0.08
174 0.07
175 0.05
176 0.05
177 0.05
178 0.05
179 0.06
180 0.08
181 0.08
182 0.09
183 0.12
184 0.18
185 0.21
186 0.25
187 0.25
188 0.26
189 0.29
190 0.31
191 0.31
192 0.28
193 0.25
194 0.23
195 0.22
196 0.19
197 0.17
198 0.16
199 0.13
200 0.11
201 0.11
202 0.1
203 0.1
204 0.1
205 0.1
206 0.09
207 0.1
208 0.11
209 0.12
210 0.13
211 0.14
212 0.14
213 0.15
214 0.18
215 0.19
216 0.2
217 0.22
218 0.23
219 0.23
220 0.23
221 0.26
222 0.23
223 0.24
224 0.25
225 0.25
226 0.23
227 0.24
228 0.32
229 0.33
230 0.36
231 0.34
232 0.3
233 0.29
234 0.3
235 0.29
236 0.23
237 0.17
238 0.14
239 0.14
240 0.15
241 0.14
242 0.13
243 0.14
244 0.13
245 0.12
246 0.13
247 0.15
248 0.15
249 0.22
250 0.23
251 0.25
252 0.24
253 0.24
254 0.29
255 0.31
256 0.33
257 0.27
258 0.27
259 0.26
260 0.26
261 0.28
262 0.23
263 0.26
264 0.25