Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5B8E8

Protein Details
Accession A0A2G5B8E8   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-32SSVSCYPTSNNTRKRRRPPYSYTALIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5mito_nucl 12.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001766  Fork_head_dom  
IPR018122  TF_fork_head_CS_1  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
Pfam View protein in Pfam  
PF00250  Forkhead  
PROSITE View protein in PROSITE  
PS00657  FORK_HEAD_1  
PS50039  FORK_HEAD_3  
CDD cd00059  FH_FOX  
Amino Acid Sequences MASTIESSVSCYPTSNNTRKRRRPPYSYTALIAQAIISSEHQQLTLRQIYDSINQMYPQMCQGPDIGWQNTIRHNLSLNQCFKRIPRQQLPISLSSSLRGRGSYWSVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.47
4 0.56
5 0.66
6 0.76
7 0.85
8 0.88
9 0.88
10 0.87
11 0.86
12 0.84
13 0.81
14 0.74
15 0.65
16 0.56
17 0.47
18 0.39
19 0.3
20 0.21
21 0.13
22 0.1
23 0.09
24 0.07
25 0.08
26 0.09
27 0.09
28 0.1
29 0.1
30 0.11
31 0.15
32 0.17
33 0.15
34 0.14
35 0.15
36 0.16
37 0.17
38 0.19
39 0.16
40 0.13
41 0.13
42 0.14
43 0.13
44 0.12
45 0.11
46 0.1
47 0.09
48 0.09
49 0.09
50 0.09
51 0.13
52 0.16
53 0.16
54 0.16
55 0.18
56 0.19
57 0.22
58 0.26
59 0.22
60 0.19
61 0.2
62 0.24
63 0.3
64 0.37
65 0.4
66 0.38
67 0.38
68 0.39
69 0.41
70 0.45
71 0.47
72 0.49
73 0.51
74 0.57
75 0.6
76 0.67
77 0.69
78 0.62
79 0.57
80 0.49
81 0.41
82 0.35
83 0.33
84 0.28
85 0.24
86 0.21
87 0.19
88 0.22