Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BEU6

Protein Details
Accession A0A2G5BEU6   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
93-124KNWFCNIRRRKLPSSIKRSKQHHRSECAKLLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001356  Homeobox_dom  
IPR008422  Homeobox_KN_domain  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF05920  Homeobox_KN  
PROSITE View protein in PROSITE  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MEAAAETVEKKFSHNELSWKACNSNTFTGRKKNLVRKTTSKKPSEKIHGKSYNENTNSVLRLWLEHNMANPYPSPQAKRELMRQTGLTKMQLKNWFCNIRRRKLPSSIKRSKQHHRSECAKLLSSLAIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.36
3 0.4
4 0.47
5 0.48
6 0.47
7 0.46
8 0.4
9 0.41
10 0.38
11 0.39
12 0.38
13 0.41
14 0.44
15 0.51
16 0.53
17 0.57
18 0.6
19 0.62
20 0.66
21 0.67
22 0.69
23 0.7
24 0.75
25 0.78
26 0.78
27 0.76
28 0.73
29 0.73
30 0.74
31 0.74
32 0.74
33 0.69
34 0.7
35 0.7
36 0.66
37 0.67
38 0.64
39 0.62
40 0.54
41 0.49
42 0.41
43 0.35
44 0.33
45 0.25
46 0.2
47 0.12
48 0.12
49 0.12
50 0.12
51 0.12
52 0.11
53 0.12
54 0.14
55 0.14
56 0.13
57 0.13
58 0.12
59 0.14
60 0.16
61 0.17
62 0.17
63 0.23
64 0.26
65 0.29
66 0.36
67 0.39
68 0.4
69 0.39
70 0.4
71 0.35
72 0.36
73 0.34
74 0.31
75 0.3
76 0.28
77 0.33
78 0.39
79 0.4
80 0.4
81 0.47
82 0.52
83 0.48
84 0.58
85 0.59
86 0.61
87 0.67
88 0.71
89 0.68
90 0.7
91 0.79
92 0.79
93 0.81
94 0.82
95 0.82
96 0.84
97 0.86
98 0.86
99 0.86
100 0.86
101 0.84
102 0.83
103 0.81
104 0.81
105 0.81
106 0.75
107 0.67
108 0.57
109 0.49