Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5BJF6

Protein Details
Accession A0A2G5BJF6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
85-104PPRPLYPKVKRSPHLARKEEBasic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000307  Ribosomal_S16  
IPR023803  Ribosomal_S16_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00886  Ribosomal_S16  
Amino Acid Sequences MVVRIRFARHGVRNRPFYHIVAMVGRSRRDGKPLEKLGTYDPLPDKKEEAKHISLDFARTKYWLGVGAQPSDAVRFLLERAGVLPPRPLYPKVKRSPHLARKEETE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.7
3 0.64
4 0.57
5 0.51
6 0.42
7 0.35
8 0.29
9 0.29
10 0.26
11 0.26
12 0.25
13 0.24
14 0.27
15 0.26
16 0.29
17 0.32
18 0.33
19 0.4
20 0.45
21 0.45
22 0.41
23 0.41
24 0.38
25 0.37
26 0.32
27 0.26
28 0.24
29 0.26
30 0.26
31 0.26
32 0.26
33 0.26
34 0.3
35 0.31
36 0.33
37 0.3
38 0.31
39 0.3
40 0.3
41 0.26
42 0.25
43 0.22
44 0.18
45 0.16
46 0.14
47 0.15
48 0.13
49 0.13
50 0.11
51 0.1
52 0.14
53 0.16
54 0.16
55 0.15
56 0.16
57 0.15
58 0.14
59 0.13
60 0.09
61 0.07
62 0.06
63 0.07
64 0.08
65 0.08
66 0.07
67 0.08
68 0.12
69 0.13
70 0.14
71 0.17
72 0.17
73 0.21
74 0.25
75 0.27
76 0.33
77 0.42
78 0.51
79 0.57
80 0.66
81 0.66
82 0.71
83 0.78
84 0.8
85 0.8
86 0.76