Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5B5C3

Protein Details
Accession A0A2G5B5C3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
96-121TQHELSRKTIRQHKKDQHFGPRQYAIHydrophilic
NLS Segment(s)
PositionSequence
76-93KKHIPKDLRAKKTRALRR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MTKVKASELRDKSQAELTQTLDQYKRELLDLKVQQVAGAAAAKSSKIRDIRKNIARVLTVITQQNRDAVRAEYAGKKHIPKDLRAKKTRALRRVMTQHELSRKTIRQHKKDQHFGPRQYAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.41
3 0.38
4 0.36
5 0.35
6 0.35
7 0.37
8 0.32
9 0.3
10 0.27
11 0.26
12 0.23
13 0.19
14 0.22
15 0.2
16 0.27
17 0.29
18 0.29
19 0.3
20 0.29
21 0.26
22 0.23
23 0.21
24 0.13
25 0.11
26 0.08
27 0.06
28 0.06
29 0.07
30 0.07
31 0.08
32 0.13
33 0.18
34 0.25
35 0.33
36 0.4
37 0.49
38 0.55
39 0.59
40 0.55
41 0.51
42 0.45
43 0.38
44 0.33
45 0.25
46 0.21
47 0.2
48 0.19
49 0.18
50 0.17
51 0.21
52 0.18
53 0.17
54 0.16
55 0.14
56 0.14
57 0.13
58 0.16
59 0.16
60 0.16
61 0.19
62 0.21
63 0.22
64 0.23
65 0.28
66 0.29
67 0.32
68 0.42
69 0.49
70 0.56
71 0.6
72 0.62
73 0.62
74 0.69
75 0.72
76 0.68
77 0.65
78 0.6
79 0.62
80 0.67
81 0.67
82 0.63
83 0.58
84 0.57
85 0.58
86 0.57
87 0.52
88 0.51
89 0.5
90 0.52
91 0.58
92 0.62
93 0.63
94 0.71
95 0.78
96 0.8
97 0.86
98 0.86
99 0.87
100 0.86
101 0.83
102 0.8
103 0.78