Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BER7

Protein Details
Accession A0A2G5BER7   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
130-156VSAPFANTKLQKKRKLKADKLKEFSYIHydrophilic
NLS Segment(s)
PositionSequence
141-146KKRKLK
Subcellular Location(s) extr 11, E.R. 4, cyto 3, golg 3, nucl 2, mito 2, vacu 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTAYKNNDKIHAHTLIDIPVLLANILNCNDKDTKALLNKNEKDPKVWSPVLNLQSTLLKNKGDCKFVENIFTDGISVCVVYKSDAALEKCRKPYKKLIVTADPASASTSAPVSVPGSVSAFVFVAVLASVSAPFANTKLQKKRKLKADKLKEFSYIYEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.3
3 0.27
4 0.22
5 0.16
6 0.12
7 0.11
8 0.09
9 0.07
10 0.06
11 0.09
12 0.1
13 0.13
14 0.12
15 0.15
16 0.17
17 0.17
18 0.19
19 0.18
20 0.23
21 0.28
22 0.34
23 0.38
24 0.47
25 0.5
26 0.58
27 0.65
28 0.58
29 0.54
30 0.53
31 0.51
32 0.48
33 0.46
34 0.37
35 0.34
36 0.4
37 0.41
38 0.37
39 0.32
40 0.25
41 0.27
42 0.27
43 0.25
44 0.2
45 0.17
46 0.17
47 0.25
48 0.27
49 0.26
50 0.25
51 0.26
52 0.28
53 0.28
54 0.32
55 0.25
56 0.22
57 0.2
58 0.19
59 0.16
60 0.11
61 0.11
62 0.06
63 0.05
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.04
70 0.06
71 0.09
72 0.11
73 0.18
74 0.23
75 0.27
76 0.34
77 0.41
78 0.43
79 0.44
80 0.52
81 0.55
82 0.59
83 0.62
84 0.61
85 0.59
86 0.61
87 0.57
88 0.48
89 0.38
90 0.3
91 0.24
92 0.18
93 0.12
94 0.09
95 0.08
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.08
103 0.08
104 0.09
105 0.09
106 0.08
107 0.07
108 0.07
109 0.07
110 0.05
111 0.05
112 0.04
113 0.04
114 0.03
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.06
122 0.13
123 0.2
124 0.29
125 0.4
126 0.49
127 0.59
128 0.69
129 0.76
130 0.8
131 0.85
132 0.87
133 0.87
134 0.89
135 0.9
136 0.87
137 0.82
138 0.76
139 0.66