Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5B3K2

Protein Details
Accession A0A2G5B3K2    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-54DNWLKIKLFKGKKKIDKPELSYTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, cyto_nucl 10, nucl 4, mito 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038279  Ndc10_dom2_sf  
IPR031872  NDC10_II  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF16787  NDC10_II  
Amino Acid Sequences QVDVCTIMAIGFYFFWHFHMTSEGFPNLADADNWLKIKLFKGKKKIDKPELSYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.11
4 0.11
5 0.11
6 0.15
7 0.15
8 0.15
9 0.18
10 0.17
11 0.14
12 0.13
13 0.13
14 0.1
15 0.09
16 0.08
17 0.06
18 0.09
19 0.11
20 0.12
21 0.12
22 0.12
23 0.13
24 0.17
25 0.25
26 0.33
27 0.38
28 0.48
29 0.58
30 0.68
31 0.78
32 0.85
33 0.86
34 0.86