Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BKU3

Protein Details
Accession A0A2G5BKU3    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-32PKTRNTFCKGKECRKHTPHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 8.5, cyto_nucl 8.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRNTFCKGKECRKHTPHKVTQYKAGKASVFAQGKRRYDRKQSGFGGQTKPVFHKKAKTTKKVVLRLECTVCKFKQQLALKRCKHFELGGDKKRKNAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.74
4 0.8
5 0.81
6 0.86
7 0.86
8 0.87
9 0.85
10 0.86
11 0.88
12 0.8
13 0.81
14 0.78
15 0.72
16 0.64
17 0.57
18 0.47
19 0.39
20 0.38
21 0.36
22 0.32
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.49
30 0.55
31 0.63
32 0.6
33 0.61
34 0.59
35 0.58
36 0.56
37 0.55
38 0.48
39 0.41
40 0.37
41 0.3
42 0.31
43 0.31
44 0.3
45 0.28
46 0.33
47 0.38
48 0.47
49 0.55
50 0.6
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.62
58 0.59
59 0.57
60 0.53
61 0.48
62 0.45
63 0.39
64 0.37
65 0.35
66 0.32
67 0.37
68 0.43
69 0.49
70 0.52
71 0.63
72 0.64
73 0.7
74 0.71
75 0.64
76 0.59
77 0.51
78 0.49
79 0.5
80 0.53
81 0.56
82 0.62
83 0.61
84 0.62
85 0.67
86 0.62