Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BK52

Protein Details
Accession A0A2G5BK52   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
208-231SETKAMFKKRRAPANRSTRKQRKVHydrophilic
NLS Segment(s)
PositionSequence
215-231KKRRAPANRSTRKQRKV
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040023  WBP4  
Gene Ontology GO:0000398  P:mRNA splicing, via spliceosome  
Amino Acid Sequences MGTHKQILSRQQHESGTKHKDSVQKYLRQIGKDSEAKQRAEDQLNDQFAKIEEAAAQSYKKDIGTSTEKISSVEKVHGSRDQSLIENATTKSQKAAEQETVAEEQQDTQTQPDRPADVGVVGAWQVIEDTDLSCSEDEHSAKGNPKSMTAEVGDTNIDLNSEPQNTAALRGAELLDEEDQHPSTRLDEFHIKEKTIESKTDPLDTNISETKAMFKKRRAPANRSTRKQRKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.56
3 0.55
4 0.52
5 0.49
6 0.5
7 0.51
8 0.5
9 0.56
10 0.56
11 0.55
12 0.57
13 0.64
14 0.63
15 0.58
16 0.57
17 0.51
18 0.51
19 0.5
20 0.48
21 0.49
22 0.5
23 0.49
24 0.47
25 0.48
26 0.46
27 0.45
28 0.44
29 0.39
30 0.41
31 0.45
32 0.43
33 0.37
34 0.31
35 0.27
36 0.27
37 0.21
38 0.14
39 0.1
40 0.11
41 0.13
42 0.13
43 0.13
44 0.11
45 0.12
46 0.13
47 0.12
48 0.11
49 0.1
50 0.15
51 0.21
52 0.23
53 0.25
54 0.27
55 0.27
56 0.27
57 0.28
58 0.25
59 0.2
60 0.21
61 0.21
62 0.19
63 0.22
64 0.24
65 0.26
66 0.25
67 0.25
68 0.23
69 0.21
70 0.21
71 0.19
72 0.16
73 0.16
74 0.14
75 0.16
76 0.16
77 0.15
78 0.15
79 0.16
80 0.18
81 0.19
82 0.22
83 0.19
84 0.2
85 0.2
86 0.2
87 0.2
88 0.17
89 0.14
90 0.1
91 0.09
92 0.08
93 0.09
94 0.08
95 0.08
96 0.12
97 0.13
98 0.15
99 0.16
100 0.16
101 0.15
102 0.15
103 0.14
104 0.1
105 0.09
106 0.06
107 0.05
108 0.04
109 0.04
110 0.03
111 0.03
112 0.03
113 0.02
114 0.03
115 0.03
116 0.03
117 0.04
118 0.04
119 0.05
120 0.05
121 0.06
122 0.07
123 0.1
124 0.1
125 0.1
126 0.12
127 0.14
128 0.19
129 0.21
130 0.25
131 0.22
132 0.24
133 0.26
134 0.25
135 0.24
136 0.2
137 0.2
138 0.15
139 0.15
140 0.14
141 0.1
142 0.1
143 0.08
144 0.07
145 0.05
146 0.07
147 0.08
148 0.09
149 0.09
150 0.09
151 0.11
152 0.11
153 0.13
154 0.14
155 0.12
156 0.11
157 0.12
158 0.12
159 0.1
160 0.1
161 0.1
162 0.08
163 0.09
164 0.09
165 0.1
166 0.11
167 0.12
168 0.13
169 0.12
170 0.13
171 0.14
172 0.14
173 0.18
174 0.25
175 0.27
176 0.34
177 0.36
178 0.36
179 0.34
180 0.37
181 0.4
182 0.35
183 0.35
184 0.32
185 0.36
186 0.37
187 0.42
188 0.4
189 0.35
190 0.35
191 0.33
192 0.34
193 0.29
194 0.29
195 0.24
196 0.23
197 0.28
198 0.31
199 0.39
200 0.41
201 0.46
202 0.55
203 0.62
204 0.73
205 0.74
206 0.75
207 0.77
208 0.81
209 0.84
210 0.84
211 0.86